Recombinant Photorhabdus luminescens subsp. laumondii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties of Recombinant Photorhabdus luminescens subsp. laumondii Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant P. luminescens subsp. laumondii Lgt is a recombinant protein derived from the bacterial species Photorhabdus luminescens subsp. laumondii (strain TT01). This enzyme facilitates the post-translational modification of prolipoproteins by transferring a diacylglyceryl group from phosphatidylglycerol to the thiol side chain of a conserved cysteine residue (+1 position) in prokaryotic lipoproteins .

Biological Function and Role in Lipoprotein Maturation

Lgt is the first enzyme in the lipoprotein biosynthesis pathway, which is critical for anchoring proteins to bacterial membranes. In P. luminescens, Lgt catalyzes the transfer of a diacylglyceryl group to prolipoproteins, enabling their proper localization to the inner membrane . This modification is essential for:

  • Membrane protein stability: Lipoproteins account for ~2% of bacterial proteins and include virulence factors, transporters, and enzymes.

  • Cell envelope integrity: Defects in Lgt activity lead to mislocalized lipoproteins and compromised cell viability, as shown in E. coli models .

Mechanism of Action

  1. Substrate Recognition: Binds phosphatidylglycerol (diacylglyceryl donor) and prolipoproteins containing the conserved "lipobox" motif (L[AS][GA]C) at the signal peptide terminus .

  2. Catalytic Transfer: Forms a thioether bond between the cysteine +1 sulfur and the diacylglyceryl group, generating a modified prolipoprotein .

  3. Subsequent Processing:

    • Signal Peptidase II (Lsp): Cleaves the signal peptide, yielding a diacylglyceryl-modified apolipoprotein.

    • Apolipoprotein N-acyltransferase (Lnt): Adds an acyl group to the N-terminal amine, completing lipoprotein maturation .

Applications in Research and Industry

The recombinant Lgt protein (source ) is utilized in:

  • ELISA Kits: For detecting Lgt-specific antibodies or studying lipoprotein modification pathways.

  • Structural Studies: To elucidate enzymatic mechanisms and substrate interactions.

  • Antibiotic Development: As a target for small-molecule inhibitors, given its essentiality in pathogens like P. luminescens .

Amino Acid Sequence Analysis

The full-length sequence of P. luminescens subsp. laumondii Lgt is provided in source . Key motifs include:

  • N-Terminal Domain: Involved in phosphatidylglycerol binding.

  • C-Terminal Domain: Contains catalytic residues critical for diacylglyceryl transfer.

Gene Context and Orthologs

SpeciesGene NameUniprot AccessionFunctional Role
E. colilgtP0A7L6Lipoprotein modification
P. luminescens subsp. laumondiiplu0622Q7N8U5Lipoprotein modification

Challenges and Future Directions

  • Mechanistic Gaps: Detailed structural data for P. luminescens Lgt remain limited compared to E. coli.

  • Therapeutic Potential: High-throughput screening for Lgt inhibitors could yield novel antimicrobials targeting entomopathogenic and human-pathogenic Photorhabdus strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; plu0622; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPNIDPVIFSIGPIALHWYGFMYLVGFVFAMWLATRRAAKPNSGWTKNEVENL LYAGFAGVFVGGRLGYVLFYNFPAFLDNPLYLFKVWDGGMSFHGGLVGVICAMWWFGRRT KRHFLQVADFIAPLVPFGLGMGRIGNFINGELWGRVTLDTPWAMLFPSSRGEDIALAATD PSLLSVLEQYGVLPRHPSQLYEMALEGIVLFIILNLYIRKPRPMGSVSGLFLIGYGIFRV IVEFFRQPDAQLGLFDGISMGQILSIPMILAGILMMIWAYKHQGNKVQEVK
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: plu:plu0622

STRING: 243265.plu0622

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Photorhabdus luminescens and what role does Prolipoprotein diacylglyceryl transferase play in its biology?

Photorhabdus luminescens is an entomopathogenic bacterium that forms an obligate symbiosis with insect parasitic nematodes of the genus Heterorhabditis. These bacteria are carried by the nematodes and released into insect larvae where they produce toxins and enzymes that kill the insect, typically within 48 hours . The bacteria also produce bioluminescent enzymes (luciferase) that cause infected insect larvae to glow .

Prolipoprotein diacylglyceryl transferase (lgt) plays a crucial role in bacterial lipoprotein biosynthesis. This enzyme catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins. This post-translational modification is essential for proper membrane anchoring of lipoproteins, which are involved in numerous cellular processes including nutrient acquisition, signaling, and virulence.

What genetic engineering techniques are available for manipulating Photorhabdus luminescens genes?

Genetic manipulation of P. luminescens can be achieved using several approaches, with recombineering being particularly effective. The Pluγβα recombineering system, derived from P. luminescens itself, offers a powerful method for genome engineering . This system is based on three host-specific phage proteins from P. luminescens: Plu2935, Plu2936, and Plu2934, which are functional analogs of Redβ, Redα, and Redγ found in E. coli's lambda Red system .

For efficient genetic manipulation, researchers can employ a pipeline that combines:

  • Pluγβα-mediated recombineering in P. luminescens

  • recET-mediated recombineering in E. coli for rapid construction of knock-in vectors

  • Traditional cloning techniques adapted for P. luminescens

This concerted approach facilitates reverse genetics, functional genomics, and bioprospecting research for Photorhabdus .

What experimental considerations should be taken into account when expressing recombinant lgt in heterologous systems?

When expressing recombinant Prolipoprotein diacylglyceryl transferase from P. luminescens in heterologous systems, several factors must be considered:

  • Temperature selection: P. luminescens exhibits temperature-dependent behavior, with most strains unable to grow above 34°C . Expression systems should be optimized for temperatures between 28-30°C for maximum protein yield and activity.

  • Cell type selection: Different strains of P. luminescens show varying behaviors at different temperatures, potentially affecting protein expression and folding .

  • Codon optimization: Adaptation of the lgt gene sequence to the codon usage bias of the host organism may be necessary to improve expression.

  • Post-translational modifications: As lgt is involved in lipoprotein modification, proper folding and activity assessment require careful experimental design.

How can researchers effectively verify the functional activity of recombinant lgt protein?

Verifying functional activity of recombinant Prolipoprotein diacylglyceryl transferase requires multiple complementary approaches:

  • In vitro enzymatic assay: Measure the transfer of diacylglyceryl groups to substrate prolipoproteins using purified recombinant lgt and appropriate lipid substrates. Activity can be detected through:

    • Radiolabeled lipid precursors

    • Mass spectrometry to detect mass shifts in substrate proteins

    • Fluorescently labeled substrates

  • Complementation studies: Transform lgt-deficient bacterial strains with the recombinant lgt gene and assess restoration of lipoprotein processing.

  • Membrane fraction analysis: Compare the membrane proteome of wild-type, lgt-deficient, and complemented strains using proteomic approaches to identify properly processed lipoproteins.

  • Structural integrity assessment: Circular dichroism and thermal shift assays can determine if the recombinant protein maintains proper folding.

What methodologies are effective for studying the temperature-dependent expression of lgt in P. luminescens?

Temperature plays a critical role in P. luminescens biology, with clinical isolates showing ability to grow at 37°C while most environmental strains cannot grow above 34°C . To study temperature-dependent expression of lgt:

  • RT-qPCR analysis: Quantify lgt transcript levels at various temperatures (28°C, 34°C, 37°C) during different growth phases.

  • Reporter gene fusions: Create transcriptional and translational fusions of the lgt promoter region with reporter genes (GFP, luciferase) to monitor expression patterns under different temperature conditions.

  • Proteomics approach: Use stable isotope labeling with amino acids in cell culture (SILAC) or label-free quantification to compare protein abundance at different temperatures.

  • Western blot analysis: Detect lgt protein levels using specific antibodies from cultures grown at different temperatures.

The Texas clinical isolate of P. luminescens provides an excellent comparative model as it can grow at 37°C unlike most other P. luminescens strains .

How do different P. luminescens strains vary in their genetic characteristics, and what implications might this have for lgt function?

P. luminescens exhibits significant strain variation based on geographic origin and source (clinical vs. environmental):

StrainOriginSourceGrowth at 37°CHuman Cell InvasionNotable Characteristics
TexasUSAClinical (neonate)YesHigh across all PBMC typesAggressive colonization strategy
TT01-DJCLaboratoryEnvironmental (soil nematode)NoLimited, primarily dendritic cellsCannot grow above 34°C
ATCC43949 (P. asymbiotica)USAClinicalYesModerateTemperature-independent invasion
Kingscliff (P. asymbiotica)AustraliaClinicalYesHigh, selective for cell typesAvoids dendritic cells

The strain variation suggests potential differences in lgt expression, regulation, and possibly substrate specificity. The Texas strain's unique ability to infect humans despite being classified as P. luminescens (not P. asymbiotica) indicates potential genetic adaptations that may involve lipoprotein processing systems .

What experimental approaches can be used to determine the role of lgt in P. luminescens pathogenicity?

To investigate the role of Prolipoprotein diacylglyceryl transferase in P. luminescens pathogenicity, researchers should consider these advanced experimental approaches:

  • Targeted gene knockout: Create lgt-deficient strains using Pluγβα recombineering and assess:

    • Bacterial survival within different immune cell types using flow cytometry

    • Ability to establish infection in insect models

    • Growth and bioluminescence patterns

  • Controlled complementation studies: Reintroduce wild-type and mutant versions of lgt to determine which functional domains are critical for pathogenicity.

  • Cell invasion assays: Compare the ability of wild-type and lgt-mutant strains to:

    • Invade THP-1 human monocytic cells at different temperatures

    • Associate with different PBMC cell types, particularly focusing on dendritic cells which show distinct interaction patterns with different Photorhabdus strains

    • Survive intracellularly using gentamicin protection assays

  • Comparative lipidomics: Analyze changes in the membrane lipid composition between wild-type and lgt-mutant strains to understand how lipoprotein modifications affect membrane properties.

  • Transcriptomics during infection: Perform RNA-seq on both the pathogen and host cells during infection to identify lgt-dependent changes in gene expression patterns.

How can researchers investigate potential interactions between lgt and the host immune system?

The interaction between P. luminescens and the host immune system shows remarkable strain-specific variation . To investigate lgt's role in these interactions:

  • Immune cell subset analysis: Use flow cytometry to determine which immune cell populations interact with wild-type versus lgt-deficient bacteria, following methods described for different P. luminescens strains .

  • Cytokine profiling: Measure immune response mediators (cytokines, chemokines) produced by human immune cells when exposed to wild-type versus lgt-mutant bacteria.

  • Pattern recognition receptor (PRR) interaction studies: Determine if lipoproteins processed by lgt are recognized by specific PRRs such as Toll-like receptors (TLRs).

  • Temperature-dependent virulence factor expression: Compare expression profiles at 28°C versus 37°C, as the Texas strain shows temperature-dependent variations in immune cell association .

  • Comparative analysis across strains: Study lgt from different Photorhabdus strains (Texas, TT01, Kingscliff) to identify strain-specific adaptations that might contribute to human pathogenicity.

What are the challenges in structural characterization of lgt and how can they be addressed?

Prolipoprotein diacylglyceryl transferase presents several challenges for structural characterization due to its membrane-associated nature:

  • Protein purification challenges:

    • Design expression constructs with removable fusion tags (His6, MBP, SUMO) to improve solubility

    • Use specialized detergents (DDM, LMNG, GDN) for extraction while maintaining native conformation

    • Consider nanodiscs or amphipols as alternative membrane mimetics

  • Crystallization strategies:

    • Lipid cubic phase (LCP) crystallization

    • Antibody-mediated crystallization using conformation-specific antibody fragments

    • Surface entropy reduction through targeted mutations

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM) for structure determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions and substrate interaction sites

    • Cross-linking mass spectrometry (XL-MS) to identify intramolecular constraints

  • Functional validation of structural insights:

    • Site-directed mutagenesis of predicted catalytic and substrate-binding residues

    • Activity assays with natural and synthetic substrates

    • Molecular dynamics simulations to understand substrate recognition and catalytic mechanisms

What are common technical challenges when working with recombinant P. luminescens proteins and how can they be overcome?

Researchers working with recombinant P. luminescens proteins face several technical challenges:

  • Temperature sensitivity:

    • Challenge: Many P. luminescens strains grow optimally at 28-30°C but cannot grow above 34°C .

    • Solution: Design expression protocols with careful temperature control; consider using the Texas strain for higher temperature applications .

  • Expression strain selection:

    • Challenge: Traditional E. coli expression systems may not produce properly folded P. luminescens proteins.

    • Solution: Consider using the Pluγβα recombineering system to express proteins in P. luminescens itself , ensuring native post-translational modifications.

  • Vector design considerations:

    • Challenge: Standard vectors may not function optimally in P. luminescens.

    • Solution: Utilize the concerted recET system in E. coli with the Pluγβα system in Photorhabdus for efficient vector construction and transformation .

  • Protein solubility issues:

    • Challenge: Membrane-associated proteins like lgt often aggregate when overexpressed.

    • Solution: Express as fusion proteins with solubility enhancers; optimize detergent conditions; consider co-expression with chaperones.

  • Validation of biological activity:

    • Challenge: Confirming that recombinant proteins retain native activity.

    • Solution: Develop functional assays based on known biological activities; compare wild-type and recombinant proteins using multiple activity parameters.

How can researchers address data inconsistencies when comparing lgt function across different Photorhabdus strains?

When comparing lgt function across different Photorhabdus strains, researchers may encounter data inconsistencies due to:

  • Strain-specific genetic background effects:

    • Approach: Create isogenic strains with lgt variants from different sources in the same genetic background

    • Analysis: Use statistical methods that account for strain variation as a factor

  • Temperature-dependent phenotypes:

    • Approach: Always test at multiple temperatures (28°C, 34°C, 37°C) since strain behaviors vary significantly with temperature

    • Analysis: Use two-way ANOVA to assess temperature and strain interactions, as demonstrated in previous studies

  • Experimental system variation:

    • Approach: Include standardized controls across all experiments; test both in tissue culture cell lines (THP-1) and primary cells (PBMCs) as done in previous studies

    • Analysis: Normalize data to internal standards; employ meta-analysis techniques for cross-study comparisons

  • Growth phase differences:

    • Approach: Synchronize cultures and harvest at defined growth phases verified by optical density measurements

    • Analysis: Track gene expression and protein activity across multiple time points rather than single measurements

What novel applications might emerge from deeper understanding of lgt function in P. luminescens?

Understanding the function of Prolipoprotein diacylglyceryl transferase in P. luminescens could lead to several innovative research applications:

  • Enhanced bioinsecticides: P. luminescens is already used as a bioinsecticide , and understanding lgt's role in virulence could lead to engineered strains with improved insecticidal properties.

  • Dual-action agricultural biologicals: P. luminescens has demonstrated both insecticidal and antifungal properties . Engineering strains with optimized lgt function might enhance both capabilities, creating more effective biological control agents.

  • Novel antimicrobial discovery: The Texas strain's ability to infect humans suggests adaptation mechanisms that could inform development of new antimicrobials targeting lipoprotein biosynthesis.

  • Biosensors and environmental monitoring: The relationship between lgt function and bioluminescence could be exploited to create biosensors for environmental monitoring.

  • Targeted drug delivery systems: Understanding how P. luminescens selectively targets different immune cell types could inform the development of cell-specific drug delivery systems.

How might comparative genomics approaches advance our understanding of lgt evolution and function across Photorhabdus species?

Comparative genomics approaches offer powerful tools for understanding lgt evolution and function:

  • Phylogenetic analysis: Construct phylogenetic trees of lgt sequences from different Photorhabdus strains to trace evolutionary relationships and identify potential horizontal gene transfer events.

  • Selective pressure analysis: Calculate Ka/Ks ratios to identify regions under positive selection, particularly in human-infective strains like the Texas clinical isolate .

  • Comparative structural modeling: Generate homology models of lgt from different strains to identify structural variations that might explain functional differences.

  • Promoter region analysis: Compare regulatory regions of lgt across strains to identify differences in expression control, particularly in relation to temperature sensing.

  • Pangenome analysis: Construct the Photorhabdus pangenome to understand the core and accessory genome components related to lgt function and lipoprotein processing.

This type of analysis could reveal how the Texas strain of P. luminescens acquired the ability to infect humans while most strains remain insect-specific, potentially identifying key adaptations in lipoprotein processing systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.