Recombinant Photorhabdus luminescens subsp. laumondii Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Functional Role and Mechanism

MdtI, in conjunction with MdtJ, excretes spermidine at neutral pH, countering its cytotoxic accumulation. Key findings include:

  • Spermidine Toxicity Mitigation: Overexpression of mdtJI in E. coli reduces intracellular spermidine levels and rescues growth under high spermidine concentrations (12 mM) .

  • Critical Residues: Mutagenesis studies identified residues in MdtJ (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82) and MdtI (Glu5, Glu19, Asp60, Trp68, Trp81) essential for spermidine transport .

  • Transport Efficiency: Cells expressing mdtJI exhibit enhanced excretion of [14C]spermidine, confirming its role in active efflux .

Production and Purification

The recombinant MdtI is produced via heterologous expression in E. coli and purified using His-tag affinity chromatography.

ParameterDetails
Expression VectorNot specified (commonly pET or similar)
InductionIPTG (isopropyl β-D-1-thiogalactopyranoside)
Purification MethodNi-NTA affinity chromatography
ReconstitutionSterile deionized water (0.1–1.0 mg/mL); glycerol addition recommended
StorageLyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thawing

Genomic and Evolutionary Context

  • Genomic Location: The mdtI gene resides in P. luminescens subsp. laumondii HP88 (draft genome: 5.27 Mbp, 4,243 genes) .

  • Pathogenicity Islands: While P. luminescens genomes harbor pathogenicity islands encoding toxins and secretion systems, mdtI is not directly linked to these regions .

  • Species-Specific Adaptation: Homologs of mdtI are present in other Photorhabdus subspecies (e.g., temperata, akhurstii), suggesting conserved roles in polyamine metabolism .

Key Experimental Insights

StudyObservationReference
Toxicity RescuemdtJI expression restored growth in E. coli with spermidine acetyltransferase deficiency
Spermidine ExcretionmdtJI-expressing cells excreted >50% more spermidine than controls
Residue-Specific MutagenesisGlu5, Asp60, Trp68 in MdtI are critical for transport activity

Potential Applications

  • Biotechnological Engineering: Modulating polyamine levels in industrial microbes for enhanced stress tolerance or metabolite production.

  • Antimicrobial Drug Development: Targeting polyamine transporters in pathogens to exploit spermidine toxicity.

  • Basic Research: Studying polyamine regulation in symbiotic bacteria and their hosts (e.g., nematodes).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
mdtI; plu2124; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
mdtI
Target Protein Sequence
MQQFEWWHAAFLFLAVVLDILANILLKLSNGFRRPWMGILSLIAVLGAFSALAQAVKGIE LSIAYALWGAFGIIATVAAGWIMFNQRLNYKGWGGIALLLLGMVMIKMA
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links

KEGG: plu:plu2124

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of MdtI protein in Photorhabdus luminescens?

    MdtI functions as part of a spermidine export protein complex that regulates polyamine levels within bacterial cells. In Photorhabdus luminescens subsp. laumondii (strain TT01), MdtI works in conjunction with MdtJ to form the MdtJI complex that catalyzes the excretion of spermidine from cells. This mechanism helps maintain cellular homeostasis by preventing toxic accumulation of spermidines, which are essential for normal cell growth but can become harmful at elevated concentrations . The protein belongs to the small multidrug resistance (SMR) family of drug exporters and plays a crucial role in polyamine regulation alongside biosynthesis, degradation, and uptake processes .

Experimental Design and Methodology

  • What are the recommended approaches for expressing recombinant MdtI protein?

    For optimal expression of recombinant Photorhabdus luminescens MdtI:

    • Expression System: E. coli is the preferred heterologous expression system due to its simplicity and high yield potential for bacterial membrane proteins.

    • Vector Selection: Vectors containing inducible promoters (such as T7) with His-tag or other affinity tags facilitate purification.

    • Induction Parameters: Expression should be induced at mid-log phase (OD600 = 0.6-0.8) with IPTG concentrations between 0.1-1.0 mM.

    • Growth Conditions: Lower temperatures (16-25°C) during induction can improve proper folding of membrane proteins.

    • Membrane Extraction: Since MdtI is a membrane protein, specialized extraction protocols using detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are essential for solubilization while maintaining protein structure and function .

    Post-expression, purification typically employs immobilized metal affinity chromatography (IMAC) for His-tagged proteins, followed by size exclusion chromatography to enhance purity.

  • How can researchers design assays to measure MdtI-mediated spermidine transport?

    To effectively measure MdtI-mediated spermidine transport, researchers can employ several complementary approaches:

    1. Fluorescence-Based Transport Assays:

      • Use fluorescently labeled spermidine analogs to track transport across cell membranes

      • Employ the Cellometer® Vision system with appropriate fluorescence optic modules (e.g., 475/535 nm)

      • Compare accumulation in cells expressing MdtI versus control cells with empty vector

    2. Radioactive Transport Assays:

      • Incubate cells with 14C or 3H-labeled spermidine

      • Measure intracellular versus extracellular radioactivity after specific time intervals

      • Calculate transport rates based on radioactive counts

    3. Liposome Reconstitution:

      • Reconstitute purified MdtI into proteoliposomes

      • Load liposomes with spermidine

      • Measure efflux rates under various conditions

    Experimental Design Example for Transport Studies:

    TubeSolutionFS (μL)Stock MdtI inhibitor (μL)DMSO (μL)Total Volume (μL)
    1FS (fluorescent spermidine)1000-101010
    2FS + 1 μM inhibitor5000.5 (1 mM stock)4.5505
    3FS + 10 μM inhibitor5000.5 (10 mM stock)4.5505
    4FS + 50 μM inhibitor5002.5 (10 mM stock)2.5505
    5FS + 100 μM inhibitor5005 (10 mM stock)0505

    For spermidine excretion confirmation, researchers should collect the reaction mixture after removing cells by centrifugation and measure polyamine levels using HPLC or LC-MS/MS methods .

  • What controls are necessary for MdtI functional studies?

    Comprehensive MdtI functional studies require multiple controls to ensure reliable and interpretable results:

    1. Vector Control: Cells transformed with empty vector to establish baseline transport activity in the absence of recombinant MdtI.

    2. Inactive Mutant Control: Cells expressing MdtI with mutations in key functional residues (e.g., E5A, E19A, D60A in E. coli MdtI) to differentiate between specific transport and non-specific effects .

    3. Alternative Substrate Control: Testing transport of structurally related polyamines (putrescine, spermine) versus unrelated compounds to confirm substrate specificity.

    4. Known Inhibitor Control: Including established inhibitors of polyamine transport to validate assay sensitivity.

    5. Transporter-Deficient Strain: Using bacterial strains with deleted endogenous mdtI/mdtJ genes to minimize background transport.

    6. Concentration Gradient Controls: Performing assays with varying substrate concentrations to establish kinetic parameters.

    7. Time-Course Controls: Measuring transport at multiple time points to distinguish between initial rates and equilibrium states.

    These controls collectively ensure that observed effects can be specifically attributed to MdtI function rather than experimental artifacts or non-specific membrane permeability.

Advanced Research Applications

  • How can site-directed mutagenesis be used to identify critical residues in MdtI function?

    Site-directed mutagenesis is a powerful approach for identifying critical residues in MdtI function. Based on studies in E. coli MdtI, several key residues (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) have been implicated in spermidine export activity . To apply this approach to Photorhabdus luminescens MdtI:

    Methodological Workflow:

    1. Selection of Target Residues:

      • Identify conserved residues through sequence alignment with E. coli MdtI

      • Focus on charged (D, E, K, R) and aromatic (W, Y, F) residues in predicted transmembrane regions

      • Consider residues in predicted substrate-binding pockets

    2. Mutagenesis Strategy:

      • Generate conservative mutations (e.g., E→D, K→R) to test charge importance

      • Create non-conservative mutations (e.g., E→A, W→A) to test essential nature

      • Design double or triple mutations to test cooperative effects

    3. Functional Assessment:

      • Compare transport activity of wild-type and mutant proteins using established assays

      • Determine changes in transport kinetics (Km, Vmax)

      • Assess changes in substrate specificity profiles

    4. Structural Validation:

      • Confirm proper protein folding and membrane integration of mutants

      • Use circular dichroism or limited proteolysis to verify structural integrity

    This approach can map the functional architecture of the MdtI protein and provide insights into the molecular mechanism of spermidine recognition and transport.

  • What approaches can be used to study the MdtJI complex formation in Photorhabdus luminescens?

    Studying MdtJI complex formation in Photorhabdus luminescens requires integrated approaches that examine protein-protein interactions while preserving the native membrane environment:

    1. Co-Expression and Co-Purification:

      • Design bicistronic constructs expressing both mdtJ and mdtI genes

      • Introduce different affinity tags on each protein (His-tag on MdtI, FLAG/Strep-tag on MdtJ)

      • Perform tandem affinity purification to isolate the intact complex

    2. Cross-Linking Mass Spectrometry:

      • Apply membrane-permeable crosslinkers (DSS, BS3) to stabilize protein complexes

      • Digest cross-linked complexes and analyze by LC-MS/MS

      • Identify interaction interfaces through cross-linked peptide mapping

    3. Förster Resonance Energy Transfer (FRET):

      • Generate fusion constructs with fluorescent proteins (e.g., MdtI-CFP, MdtJ-YFP)

      • Express in living cells and measure FRET efficiency

      • Quantify protein proximity and interaction dynamics

    4. Bacterial Two-Hybrid Assays:

      • Adapt membrane protein two-hybrid systems for MdtJ-MdtI interaction studies

      • Create fusion constructs with split reporter proteins

      • Quantify reporter activity as a measure of protein interaction

    5. Co-Immunoprecipitation:

      • Generate specific antibodies against MdtI and MdtJ

      • Perform pull-down experiments from membrane fractions

      • Identify interacting partners by western blotting or mass spectrometry

    These complementary approaches can provide insights into the stoichiometry, stability, and functional significance of the MdtJI complex in Photorhabdus luminescens.

  • How can transcriptional regulation of mdtI be studied in Photorhabdus luminescens?

    Studying transcriptional regulation of mdtI in Photorhabdus luminescens requires multiple approaches to understand expression patterns under various conditions:

    1. Quantitative RT-PCR Analysis:

      • Design primers specific to Photorhabdus luminescens mdtI

      • Normalize expression to established reference genes

      • Compare expression under various conditions (polyamine stress, growth phases)

    2. Promoter Analysis and Reporter Systems:

      • Clone the putative mdtI promoter region upstream of reporter genes (GFP, luciferase)

      • Generate truncated promoter constructs to identify key regulatory elements

      • Measure reporter activity under various conditions

    3. Transcriptome Analysis:

      • Perform RNA-Seq under conditions that might regulate mdtI expression

      • Compare expression patterns of mdtI with other polyamine-responsive genes

      • Identify co-regulated gene clusters

    4. Chromatin Immunoprecipitation (ChIP):

      • Identify transcription factors binding to the mdtI promoter

      • Perform ChIP-seq to map genome-wide binding sites

      • Validate specific interactions with EMSA or footprinting assays

    5. CRISPR Interference (CRISPRi):

      • Target dCas9 to different regions of the mdtI promoter

      • Measure effects on transcription

      • Map key regulatory elements through systematic targeting

    Based on research in E. coli, spermidine levels can increase mdtJI mRNA expression , suggesting similar polyamine-responsive regulation might exist in Photorhabdus luminescens. This regulatory mechanism should be investigated specifically in the context of the organism's lifecycle and ecological niche.

Data Analysis and Interpretation

  • How should researchers analyze contradictions in MdtI functional data?

    Analyzing contradictions in MdtI functional data requires a structured approach to distinguish genuine biological variability from methodological artifacts. Researchers should:

    1. Apply Structured Contradiction Analysis:

      • Categorize contradictions using the (α, β, θ) notation system, where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of Boolean rules needed to assess these contradictions

      • For example, contradictions between MdtI expression levels and transport activity could be classified as (2,1,1) class contradictions

    2. Reconcile Methodological Differences:

      • Compare experimental conditions (expression systems, buffer compositions, temperature)

      • Evaluate differences in protein constructs (tags, linkers, truncations)

      • Consider species-specific differences if comparing orthologs

    3. Address Biological Variability:

      • Determine if contradictions arise from different growth phases or stress conditions

      • Consider potential post-translational modifications affecting activity

      • Evaluate effects of membrane composition on transporter function

    4. Perform Meta-Analysis:

      • Compile data from multiple studies using standardized metrics

      • Apply statistical methods to identify outliers or systematic biases

      • Calculate effect sizes to quantify the magnitude of contradictions

    5. Design Validation Experiments:

      • Test competing hypotheses with carefully controlled experiments

      • Include positive and negative controls that specifically address contradictions

      • Repeat key experiments in different laboratories to confirm reproducibility

    This systematic approach helps researchers identify the source of contradictions and develop more accurate models of MdtI function.

  • What statistical approaches are appropriate for analyzing MdtI transport kinetics data?

    Analysis of MdtI transport kinetics requires appropriate statistical approaches to accurately interpret experimental data:

    1. Nonlinear Regression for Kinetic Parameters:

      • Fit spermidine transport data to Michaelis-Menten, Hill, or other appropriate models

      • Use least squares or maximum likelihood estimation methods

      • Calculate Km, Vmax, and Hill coefficients with confidence intervals

    2. Statistical Comparisons Between Conditions:

      • Apply ANOVA with post-hoc tests for multiple condition comparisons

      • Use paired t-tests for before/after inhibitor comparisons

      • Implement non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

    3. Linear Mixed-Effects Models:

      • Account for random effects from different batches or preparations

      • Incorporate fixed effects of experimental variables

      • Improve estimation by accounting for nested data structures

    4. Bootstrap Resampling for Robust Parameter Estimation:

      • Generate confidence intervals for kinetic parameters

      • Assess parameter stability across different experimental conditions

      • Create resampled distribution of mutation burdens for control samples

    5. Model Selection Criteria:

      • Use Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC)

      • Compare competing transport mechanisms (e.g., simple vs. cooperative binding)

      • Select parsimonious models that best explain the observed data

    When analyzing efflux transporter data, calculating the efflux ratio (basolateral-to-apical/apical-to-basolateral permeability) is crucial, with values greater than 2 typically indicating substrate transport . Proper statistical analysis helps distinguish between specific MdtI-mediated transport and non-specific membrane permeability.

  • How can researchers determine if MdtI functions independently or requires partner proteins in Photorhabdus luminescens?

    Determining whether MdtI functions independently or requires partners in Photorhabdus luminescens requires multiple complementary approaches:

    1. Reconstitution Studies:

      • Express and purify MdtI alone in proteoliposomes

      • Compare transport activity with and without potential partner proteins

      • Measure kinetic parameters under both conditions

    2. Genetic Complementation:

      • Create knockout strains (ΔmdtI, ΔmdtJ, double knockout)

      • Complement with mdtI alone or in combination with partner genes

      • Assess restoration of spermidine export phenotypes

    3. Co-Expression Analysis:

      • Analyze transcriptomic data to identify genes co-regulated with mdtI

      • Look for conserved operonic structures across related species

      • Identify potential functional partners through correlation analysis

    4. Protein-Protein Interaction Screening:

      • Perform pull-down assays with tagged MdtI

      • Use proximity labeling techniques (BioID, APEX) to identify interactors

      • Validate interactions with reciprocal co-immunoprecipitation

    5. Comparative Analysis with E. coli System:

      • Based on E. coli studies showing both MdtJ and MdtI are necessary for recovery from spermidine toxicity

      • Test whether the same dependency exists in Photorhabdus

      • Compare sequence conservation in interaction domains

    6. Structure-Function Analysis:

      • Create MdtI chimeras with domains from different species

      • Test which regions are essential for partner protein interactions

      • Model potential interaction interfaces using structural prediction tools

    This multi-faceted approach can establish whether Photorhabdus luminescens MdtI requires MdtJ or other partners for functional spermidine export, similar to what has been observed in E. coli .

Translational Research Applications

  • How might understanding MdtI function contribute to antimicrobial development against Photorhabdus infections?

    Understanding MdtI function could inform novel antimicrobial strategies against Photorhabdus infections through several mechanisms:

    1. Polyamine Homeostasis Disruption:

      • Develop inhibitors that block MdtI-mediated spermidine export

      • Create polyamine analogs that accumulate intracellularly to toxic levels

      • Design compounds that disrupt MdtJ-MdtI complex formation

    2. Bacterial Vulnerability Exploitation:

      • Identify conditions where MdtI function becomes essential for bacterial survival

      • Target pathogens in high-polyamine environments (e.g., infected tissues)

      • Combine with treatments that increase intracellular polyamine synthesis

    3. Virulence Modulation:

      • Investigate links between polyamine homeostasis and virulence factor expression

      • Determine if MdtI inhibition affects Photorhabdus insecticidal toxin production

      • Explore impacts on symbiotic relationships with nematode partners

    4. Resistance Mechanism Targeting:

      • Explore MdtI's potential role in antimicrobial resistance

      • Develop adjuvants that inhibit MdtI to enhance existing antibiotic efficacy

      • Target redundant export systems simultaneously to overcome resistance

    5. Agricultural Applications:

      • Develop compounds that specifically enhance Photorhabdus insecticidal activity

      • Improve biocontrol applications by optimizing polyamine-dependent pathogenicity

      • Engineer strains with modified MdtI expression for enhanced biopesticide activity

    Research indicates Photorhabdus species possess various toxins and compounds with distinct modes of action , suggesting the polyamine export system could interconnect with these pathogenicity mechanisms, offering potential targets for antimicrobial development.

  • What are the implications of MdtI function for understanding the Photorhabdus-Heterorhabditis symbiotic relationship?

    The function of MdtI in Photorhabdus luminescens may have significant implications for understanding its symbiotic relationship with Heterorhabditis nematodes:

    1. Polyamine Regulation in Symbiosis:

      • Polyamines are essential for normal cell growth and may regulate bacterial density within the nematode

      • MdtI-mediated spermidine export could help maintain optimal polyamine levels in the shared environment

      • Regulated polyamine exchange might serve as a molecular communication mechanism

    2. Stress Adaptation During Host Switching:

      • Photorhabdus transitions between nematode and insect hosts, encountering different polyamine concentrations

      • MdtI function may facilitate adaptation to these changing environments

      • Export system could protect bacteria from toxic polyamine levels during host invasion

    3. Contributions to Insect Pathogenicity:

      • Polyamine regulation may coordinate with expression of insecticidal factors

      • MdtI activity could modulate toxin production in response to host-derived signals

      • The export system might protect Photorhabdus from defensive polyamines produced by insect hosts

    4. Metabolic Integration:

      • Polyamine metabolism might be coordinated between bacterial and nematode partners

      • MdtI-exported spermidine could serve as a metabolic resource for the nematode

      • Symbiotic fitness may depend on optimized polyamine exchange

    5. Colonization Competence:

      • MdtI function may influence Photorhabdus' ability to colonize specific nematode tissues

      • Polyamine export could create favorable microenvironments for bacterial persistence

      • Differences in MdtI activity might contribute to host specificity among Photorhabdus strains

    Understanding these dynamics could provide insights into the molecular foundations of this specialized symbiotic relationship and potentially inform strategies to enhance the effectiveness of Heterorhabditis-Photorhabdus complexes in biocontrol applications .

  • How can computational approaches advance our understanding of MdtI structure and function?

    Computational approaches can significantly advance understanding of MdtI structure and function through:

    1. Homology Modeling and Structure Prediction:

      • Generate 3D models of Photorhabdus luminescens MdtI using AlphaFold2 or RoseTTAFold

      • Refine models with molecular dynamics simulations in membrane environments

      • Identify potential substrate binding sites and transport pathways

    2. Molecular Docking and Virtual Screening:

      • Dock spermidine and related polyamines to predict binding modes

      • Screen virtual compound libraries to identify potential inhibitors

      • Rank compounds based on predicted binding affinity and interaction patterns

    3. Molecular Dynamics Simulations:

      • Model MdtI behavior in lipid bilayers over extended timescales

      • Investigate conformational changes during transport cycles

      • Simulate effects of mutations on protein stability and function

    4. Coevolution Analysis:

      • Identify co-evolving residue networks that may indicate functional coupling

      • Predict interaction interfaces with partner proteins like MdtJ

      • Map evolutionary constraints to structural features

    5. Systems Biology Modeling:

      • Create kinetic models of polyamine transport pathways

      • Simulate cellular responses to varying spermidine concentrations

      • Predict emergent properties of transport system perturbations

    6. Machine Learning Applications:

      • Develop predictive models of substrate specificity based on sequence features

      • Classify potential inhibitors using structure-activity relationships

      • Identify gene expression patterns correlated with mdtI regulation

    These computational approaches can generate testable hypotheses about MdtI structure-function relationships, guide experimental design, and accelerate the discovery of modulators or inhibitors of MdtI activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.