Recombinant Photorhabdus luminescens subsp. laumondii Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement, and we will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; plu2123; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
mdtJ
Target Protein Sequence
MIYWLFLAMAIITEVIGTLSMKHASVSGGVVGMAVMYIMIATSYILLAMAVKKVALGVAY ALWEGVGILFITVFSVMWFDESLSLMKVGGLALLITGIMLIKSGTRKAAVKKSAEVVKQM ANKAVSVATTKSSKIKEA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links

KEGG: plu:plu2123

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Photorhabdus luminescens and what ecological role does it play?

Photorhabdus luminescens is an entomopathogenic bacterium that forms an obligate symbiotic relationship with soil-dwelling insect parasitic nematodes of the genus Heterorhabditis. In this symbiosis, the nematode's infective juvenile stage carries P. luminescens in its gut while searching for insect larvae in soil. Upon locating a suitable host, the nematode burrows into the insect and regurgitates P. luminescens bacteria, which then release a variety of toxins and enzymes that kill the insect host, typically within 48 hours. The bacteria then replicate within the insect cadaver, providing nutrients for nematode reproduction and development .

What is the putative function of the MdtJ protein in P. luminescens?

The MdtJ protein in P. luminescens is classified as a spermidine export protein belonging to the Small Multidrug Resistance (SMR) family of transporters. Its primary function appears to be the export of spermidine, a polyamine compound essential for various cellular processes. In bacterial systems, spermidine export proteins like MdtJ play crucial roles in:

  • Maintaining polyamine homeostasis by regulating intracellular spermidine concentrations

  • Contributing to stress responses, particularly under conditions that lead to polyamine toxicity

  • Potentially participating in detoxification mechanisms by extruding harmful compounds

  • Possibly contributing to virulence mechanisms during host infection

The functional characterization of MdtJ in P. luminescens specifically remains an active area of research, with studies needed to confirm its transport substrates and regulatory mechanisms in this particular bacterial species.

How does temperature affect gene expression and protein function in P. luminescens?

Temperature is a critical environmental factor that significantly influences both gene expression and protein function in P. luminescens. This bacterium must adapt to different thermal environments during its lifecycle—from soil temperatures (around 28°C) to the higher temperatures of insect (approximately 30-37°C) or human hosts (37°C).

Research with different Photorhabdus strains has demonstrated that growth temperature affects their ability to infect and survive within mammalian cells. For example, the Australian P. asymbiotica Kingscliff strain shows increased infectivity when grown at 37°C compared to 28°C, while the Texas strain of P. luminescens exhibits consistent invasion rates regardless of growth temperature .

For membrane transport proteins like MdtJ, temperature changes can impact:

  • Expression levels through temperature-sensitive promoters

  • Protein folding and stability in the membrane

  • Transport kinetics and substrate specificity

  • Interaction with other cellular components

These temperature-dependent effects likely reflect evolutionary adaptations of different Photorhabdus strains to their specific ecological niches and host ranges. Understanding how temperature influences the expression and function of proteins like MdtJ is essential for characterizing the physiological adaptations that enable certain strains to transition from insect to human pathogenicity .

What experimental approaches are suitable for studying the transport mechanism of MdtJ?

Investigating the transport mechanism of MdtJ requires a multi-disciplinary approach combining structural, biochemical, and biophysical techniques:

Structural Studies:

  • X-ray crystallography or cryo-electron microscopy to determine high-resolution structures of MdtJ in different conformational states

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy to monitor conformational changes during transport cycles

  • Molecular dynamics simulations to model substrate binding and translocation pathways

Functional Assays:

  • Reconstitution of purified MdtJ into liposomes loaded with fluorescent spermidine analogs to directly measure transport kinetics

  • Isothermal titration calorimetry (ITC) to determine binding affinities for spermidine and other potential substrates

  • Electrophysiology techniques such as patch-clamping or planar lipid bilayer recordings to measure ion conductance associated with transport

Cellular Studies:

  • Generation of MdtJ knockout and overexpression strains to assess phenotypic changes related to polyamine metabolism

  • Fluorescence microscopy with labeled spermidine analogs to visualize transport in living cells

  • Metabolomic profiling to quantify changes in polyamine levels in response to altered MdtJ expression

These approaches can be complemented by studying MdtJ in different temperature conditions (28°C vs. 37°C) to understand how thermal environment affects transport function, particularly relevant given the temperature-dependent behavior observed in various Photorhabdus strains .

What is known about the potential role of MdtJ in P. luminescens virulence?

While the specific role of MdtJ in P. luminescens virulence has not been directly characterized, we can make informed hypotheses based on our understanding of polyamine transporters in bacterial pathogenesis:

Potential Virulence Mechanisms:

  • Polyamine homeostasis during infection: MdtJ may help regulate intracellular polyamine levels during host colonization, as polyamines are critical for bacterial stress responses and adaptation to host environments.

  • Host immune evasion: The P. luminescens Texas strain demonstrates the ability to survive within multiple human immune cell types . Polyamine transport proteins might contribute to this survival by maintaining optimal intracellular conditions under immune stress.

  • Toxin delivery system support: P. luminescens employs a sophisticated toxin delivery system (Toxin Complex or TC) to inject effector proteins into host cells . Polyamine transporters could potentially modulate the membrane properties necessary for efficient toxin secretion or assembly.

  • Temperature adaptation: Given the temperature-dependent behavior of Photorhabdus strains , MdtJ might play a role in adaptation to the higher temperatures encountered during mammalian infection (37°C) compared to insect hosts or soil environments.

To investigate these potential roles, researchers could employ:

  • Comparative transcriptomic analysis of MdtJ expression during infection of different hosts

  • Infection models using MdtJ knockout strains

  • Co-immunoprecipitation studies to identify interaction partners during infection

  • Metabolomic analysis of polyamine dynamics during host cell invasion

Understanding MdtJ's role in virulence could provide insights into the mechanisms that enable P. luminescens to transition from an insect pathogen to a human pathogen, as observed with the Texas strain .

How can recombinant MdtJ protein be engineered for structural and functional studies?

Engineering recombinant MdtJ for structural and functional studies presents several challenges due to its nature as a membrane protein. A comprehensive strategy includes:

Expression System Design:

  • Construct optimization:

    • Codon optimization for expression host

    • Addition of purification tags (His6, FLAG, etc.) at N- or C-terminus with TEV protease cleavage sites

    • Fusion partners (e.g., MBP, SUMO) to enhance solubility

    • GFP fusion to monitor expression and folding

  • Expression host selection:

    • E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3))

    • Cell-free expression systems for direct incorporation into nanodiscs or liposomes

    • Yeast or insect cell systems for eukaryotic post-translational processing if required

Purification Strategy:

  • Membrane isolation by ultracentrifugation following cell disruption

  • Solubilization screening with various detergents (DDM, LMNG, etc.)

  • Affinity chromatography followed by size exclusion chromatography

  • Reconstitution into membrane mimetics (nanodiscs, liposomes, amphipols)

Functional Verification:

  • Circular dichroism to confirm proper folding

  • Substrate binding assays using fluorescence-based techniques

  • Transport assays in proteoliposomes

  • Activity assays at different temperatures (28°C vs. 37°C) to mimic environmental conditions

Structural Stabilization:

  • Systematic mutagenesis to identify stabilizing mutations

  • Antibody fragment (Fab) or nanobody complexation to stabilize specific conformations

  • Thermostabilization through consensus design approach

For functional studies, site-directed mutagenesis of conserved residues can identify amino acids critical for substrate binding and translocation. Mutations can be designed based on structural models and evolutionary conservation analysis, with transport activity measured using fluorescent spermidine analogs in reconstituted systems.

This engineering approach can be adapted from successful strategies used for other bacterial transporters, including those studied in Toxin Complex (TC) delivery systems from P. luminescens .

What experimental design considerations are important when studying temperature-dependent effects on MdtJ function?

When investigating how temperature affects MdtJ function in P. luminescens, a well-designed experimental approach is essential to obtain reliable and biologically relevant results. Key experimental design considerations include:

Control Variables and Standardization:

  • Growth media composition must be identical across temperature conditions

  • Growth phase standardization (e.g., mid-log phase) for all experiments

  • pH control, as temperature can affect medium pH

  • Equivalent bacterial densities across experiments (standardized OD600)

Temperature Regimes:

  • Include environmentally relevant temperatures:

    • 28°C (soil/nematode environment)

    • 30-37°C (insect host temperature range)

    • 37°C (human body temperature)

  • Consider temperature shift experiments to mimic host invasion scenarios (e.g., 28°C → 37°C)

  • Include appropriate controls for each temperature regime

Experimental Design Approaches:

  • Factorial design to examine interactions between temperature and other variables (e.g., pH, nutrient availability)

  • Time-course studies to capture temporal dynamics of adaptation

  • Statistical power analysis to determine appropriate replication

Response Variables:

  • Gene expression (RT-qPCR, RNA-Seq)

  • Protein levels (Western blot, proteomics)

  • Transport activity (fluorescent substrate uptake/export)

  • Membrane composition analysis (lipidomics)

  • Cellular phenotypes related to polyamine metabolism

Data Analysis:

  • Use appropriate statistical tests for multiple temperature comparisons

  • Consider temperature as a continuous rather than categorical variable where appropriate

  • Employ mathematical models to describe temperature-dependent kinetics

This design framework aligns with the established principles for experimental design in biological research and should allow for robust analysis of how temperature affects MdtJ expression, localization, and function in P. luminescens.

How can researchers address contradictory data when studying MdtJ function in different experimental systems?

Addressing contradictory data is a common challenge in molecular biology research, particularly when studying membrane proteins like MdtJ across different experimental systems. A systematic approach to resolve contradictions includes:

Data Validation Strategy:

  • Methodological verification:

    • Confirm reagent quality and specificity (antibodies, substrates, etc.)

    • Validate assay sensitivity and dynamic range

    • Verify cell/membrane integrity in transport assays

    • Ensure proper controls are included and functioning

  • Cross-methodology validation:

    • Employ orthogonal techniques to measure the same parameter

    • For example, combine radioisotope transport assays with fluorescence-based methods

    • Supplement functional assays with binding studies

  • System-specific characterization:

    • Compare native membrane vs. reconstituted systems

    • Assess lipid composition effects on transport activity

    • Evaluate protein orientation in different membrane systems

Common Sources of Contradictions:

  • Expression system artifacts:

    Expression SystemPotential ArtifactsMitigation Strategy
    E. coliImproper folding, inclusion bodiesOptimize growth temperature, use specialized strains
    Cell-free systemsIncomplete translation, aggregationOptimize detergent/lipid composition
    Eukaryotic cellsPost-translational modificationsCompare with unmodified protein from bacterial source
  • Assay-specific limitations:

    Assay TypeLimitationsComplementary Approaches
    Transport assaysBackground leakage, substrate degradationMultiple substrate concentrations, inhibitor controls
    Binding studiesSurface artifacts, non-specific bindingMultiple binding detection methods
    Structural analysisDetergent-induced conformational changesCompare multiple membrane mimetics

Integration Framework:

  • Develop a comprehensive model that accounts for system-specific variables

  • Weight evidence based on methodological strength and biological relevance

  • Identify conditions under which contradictions occur and incorporate these as model parameters

  • Consider environment-specific adaptations (e.g., temperature effects) as explanatory factors

Collaborative Resolution:

  • Engage multiple laboratories to independently verify key findings

  • Standardize protocols across research groups

  • Share reagents and resources to minimize technical variability

This approach acknowledges that contradictions often reflect biological complexity rather than experimental errors, particularly when studying proteins like MdtJ that may have evolved temperature-dependent functions in different P. luminescens strains, as seen with other proteins in this organism .

What approaches can be used to study potential adaptations of MdtJ for biotechnological applications?

The study of MdtJ from P. luminescens holds significant biotechnological potential, particularly given the demonstrated ability of Photorhabdus toxin complexes to deliver molecular cargo into mammalian cells . Several approaches can be employed to explore and develop MdtJ for biotechnological applications:

Protein Engineering Strategies:

  • Structure-guided engineering:

    • Modify substrate binding pocket to accommodate non-natural polyamines or therapeutic molecules

    • Engineer temperature-responsive transport activity based on insights from temperature-dependent P. luminescens strains

    • Create chimeric transporters combining domains from different polyamine transporters

  • High-throughput screening platforms:

    • Develop fluorescence-based assays to screen MdtJ variants

    • Establish selection systems where cell survival depends on modified MdtJ function

    • Apply directed evolution to generate variants with enhanced stability or altered specificity

Biotechnological Applications Development:

  • Drug delivery systems:

    ApplicationEngineering ApproachAssessment Methods
    Polyamine-drug conjugate transportModify substrate specificityFluorescence microscopy, cytotoxicity assays
    Controlled release systemsTemperature-responsive variantsTime-resolved transport assays
    Targeted deliveryFusion with targeting domainsCell-specific uptake studies
  • Biosensing platforms:

    • Engineer MdtJ-based biosensors for polyamine detection

    • Couple transport activity to reporter systems (fluorescence, electrical)

    • Develop cell-free sensing platforms using reconstituted MdtJ

  • Integration with existing delivery systems:

    • Combine with Photorhabdus toxin complex (PTC) technology, which has demonstrated ability to deliver diverse protein toxins into mammalian cells

    • Explore synergies between MdtJ and the syringe-like nanomachine of PTC

    • Investigate potential for dual-delivery systems combining polyamine transport with protein delivery

Evaluation Framework:

  • Functional characterization:

    • Transport kinetics (Km, Vmax) for natural and modified substrates

    • Temperature-dependent activity profiles

    • Stability in different environments

  • Cellular studies:

    • Uptake efficiency in different cell types

    • Cytotoxicity assessment

    • Intracellular fate tracking

  • Comparative assessment:

    • Benchmark against existing delivery technologies

    • Evaluate advantages compared to other Photorhabdus-derived systems like PTC

This research direction could leverage the natural adaptability of P. luminescens proteins to different hosts and temperatures , potentially creating biotechnological tools with tunable properties for various applications in research and medicine.

What are the key knowledge gaps in our understanding of MdtJ from P. luminescens?

Despite advances in understanding Photorhabdus bacteria, several significant knowledge gaps remain regarding the MdtJ spermidine export protein:

  • Structural characterization - No high-resolution structure of P. luminescens MdtJ currently exists, limiting our understanding of its transport mechanism and substrate specificity

  • Physiological role - The precise contribution of MdtJ to P. luminescens biology, particularly during host infection and temperature adaptation, remains unclear

  • Regulatory networks - The factors controlling mdtJ gene expression during different life cycle stages and environmental conditions are poorly characterized

  • Evolutionary adaptations - How MdtJ variants in different P. luminescens strains might contribute to their host range and pathogenicity profiles requires further investigation

  • Functional interactions - Potential interactions between MdtJ and other transport or virulence systems, such as the Toxin Complex (TC), are unexplored

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, molecular genetics, biochemistry, and infection biology.

How might future research on MdtJ inform our understanding of bacterial adaptation to different hosts?

Research on MdtJ could provide valuable insights into the mechanisms underlying bacterial host adaptation, particularly the transition from insect to human pathogenicity observed in certain Photorhabdus strains :

  • Comparative genomic and functional studies of MdtJ across geographical isolates could reveal adaptations associated with human pathogenicity, similar to the differences observed between various P. asymbiotica and P. luminescens strains

  • Temperature-responsive elements in MdtJ structure or regulation might illuminate adaptation mechanisms between soil/insect environments (28°C) and mammalian hosts (37°C)

  • Investigation of MdtJ's role in polyamine homeostasis could reveal how metabolic adaptations support survival in different host environments and immune cell types

  • Integration of MdtJ research with studies on the Photorhabdus Toxin Complex could provide a more comprehensive model of how these bacteria deploy multiple systems to establish infections in diverse hosts

As bio-pesticides based on Photorhabdus see increasing use in agriculture, understanding the molecular basis of host adaptation becomes increasingly important for biosafety considerations . Research on membrane transporters like MdtJ may provide critical insights into the factors that enable certain bacterial strains to cross species barriers and establish infections in new hosts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.