Recombinant Photorhabdus luminescens subsp. laumondii Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
uppP; bacA; upk; plu3973; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
uppP
Target Protein Sequence
MTDLSTLFHAAILGVVEGLTEFLPVSSTGHMIIVGHMLGFTGDKAETFEVIIQLGSILAV VVVFWRRLFGLIGIHFGEVPHEGKTNGKLKLSHIILAMLPAVTLGLMFHDVIKSLFNPQS VMYALVIGGVLLITAEILKPKTPKAEGLDDITYRQAFMIGCFQCLALWPGFSRSGATISG GMLMGVNRYTASEFSFILAVPMMMGASGLDLYKSLHFLSASDIPMFAVGFVTAFVVALVA IKTFLALIKRISFIPFAIYRFIVAAAVYWVFM
Uniprot No.

Target Background

Function
This enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP), conferring resistance to bacitracin.
Database Links

KEGG: plu:plu3973

STRING: 243265.plu3973

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Photorhabdus luminescens subsp. laumondii Undecaprenyl-diphosphatase (uppP)?

Undecaprenyl-diphosphatase (uppP) from Photorhabdus luminescens subsp. laumondii (strain TT01) is a membrane-bound enzyme (EC 3.6.1.27) that plays a crucial role in bacterial cell wall biosynthesis. This protein is also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase, encoded by the uppP gene (synonyms: bacA, upk) with the ordered locus name plu3973. The protein consists of 272 amino acids and functions as a phosphatase that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P), a critical carrier lipid in peptidoglycan biosynthesis .

What are the structural and functional characteristics of P. luminescens uppP?

P. luminescens uppP belongs to a family of membrane phosphatases with distinct functional domains. The protein contains multiple transmembrane regions that anchor it to the bacterial membrane, with catalytic residues that are essential for its phosphatase activity. Key catalytic residues include E21, S26, S27, and R174, which are involved in substrate binding and catalysis. Mutagenesis studies have shown that S26 and S27 can partially compensate for each other, while R174 is critical for generating the phosphoenzyme intermediate during catalysis . The enzyme specifically dephosphorylates undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P) without further phosphorolysis to undecaprenol, demonstrating high substrate specificity .

How are recombinant uppP proteins typically expressed and purified?

Recombinant expression of membrane proteins like uppP requires specialized approaches. The protein can be expressed using T7lac inducible promoter systems in E. coli, such as the pET21_NESG expression vector with a C-terminal His tag for purification . Successful expression often depends on optimizing the accessibility of translation initiation sites, which can be predicted using mRNA base-unpairing across the Boltzmann's ensemble . Following expression, the protein can be purified using immobilized metal affinity chromatography (IMAC), taking care to maintain the integrity of the membrane protein with appropriate detergents like LDAO (lauryldimethylamine oxide) at 0.05% . For functional studies, the protein should be maintained in a buffer containing 200 mM ammonium acetate (pH 8.0) with suitable detergents to preserve its native conformation and activity .

What factors affect the expression yield of recombinant P. luminescens uppP?

Multiple factors influence the expression yield of recombinant P. luminescens uppP, with mRNA accessibility being particularly significant. Analysis of 11,430 recombinant protein expression experiments has revealed that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across the Boltzmann's ensemble, is a crucial determinant of expression success . Optimizing the first nine codons with synonymous substitutions can significantly enhance expression levels without changing the amino acid sequence. Additional factors include:

FactorImpact on ExpressionOptimization Strategy
mRNA accessibilityHigh accessibility correlates with successful expressionSynonymous codon optimization of translation initiation sites
Host strainDifferent E. coli strains have varying expression capacitiesSelect strains optimized for membrane protein expression
Induction conditionsTemperature, inducer concentration, and timing affect yieldsOptimize through factorial experimental design
Protein toxicityHigh expression can be toxic to host cellsBalance expression levels using tunable promoters
Codon usageRare codons can limit expressionOptimize codons based on host preferences

Stochastic simulation models indicate that higher accessibility leads to higher protein production but slower cell growth, supporting the concept of protein cost, where cell growth is constrained during overexpression .

How can the enzymatic activity of uppP be measured in vitro?

Several methodologies can be employed to measure the enzymatic activity of recombinant uppP in vitro:

  • Real-time mass spectrometry monitoring: Native mass spectrometry can be used to track the dephosphorylation of undecaprenyl pyrophosphate in real-time. This approach allows direct observation of enzyme-substrate complexes, product formation, and reaction kinetics. The reaction can be performed in a buffer containing 200 mM ammonium acetate (pH 8.0) and 0.05% LDAO, with spectra recorded at different time intervals to monitor the reaction progress .

  • Coupled enzyme assays: The release of inorganic phosphate during the dephosphorylation reaction can be measured using colorimetric assays such as the malachite green assay or coupled enzyme systems that utilize the released phosphate.

  • Substrate analog assays: Shorter chain substrates like C15-PP can be used as model substrates for in vitro assays, though they typically show slower processing rates compared to the native C55-PP substrate .

When designing uppP activity assays, researchers should consider the influence of divalent cations, as the addition of EDTA (20 μM) can slow the reaction rate, allowing better visualization of intermediates during real-time monitoring .

What is the substrate specificity of P. luminescens uppP?

P. luminescens uppP demonstrates distinct substrate preferences that are important for experimental design:

SubstrateRelative Binding AffinityProcessing RateNotes
C55-PP (natural substrate)HighestFastestComplete processing occurs within 5 minutes under standard conditions
C15-PP (shorter analog)Lower (50% of C55-PP)SlowerUseful for capturing intermediates due to slower processing
DGPP (alternative substrate)Comparable to C55-PPNot specifiedCan be used as an alternative substrate
PGP, Lyso-PARecognized by related phosphatasesNot specific to uppPNot preferred substrates for uppP

The specificity of uppP for undecaprenyl pyrophosphate is consistent with its biological role in peptidoglycan biosynthesis. The enzyme specifically dephosphorylates the terminal phosphate of C55-PP to produce C55-P without further dephosphorylation to undecaprenol, highlighting its precise role in the lipid carrier cycle .

How do phospholipids affect the stability and activity of uppP?

Phospholipids play a crucial role in stabilizing uppP and modulating its enzymatic activity. Native mass spectrometry analysis has revealed that Photorhabdus luminescens uppP exists both in an apo form and in complex with phospholipid species, particularly phosphatidylethanolamine (PE) . Detailed characterization identified PE(16:0/17:1) as a significant bound lipid, with a mass of approximately 702 Da. The presence of phosphatidylethanolamine significantly enhances the stability of uppP dimers and unexpectedly increases the rate of substrate processing .

Experimental investigations using defined lipid compositions demonstrated that 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine (POPE) and 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol (POPG), which represent the two most abundant lipid classes in E. coli membranes, affect uppP activity differently . This lipid dependency highlights the importance of the membrane environment for proper uppP function and should be considered when designing in vitro assays and interpreting results.

What is the impact of site-directed mutagenesis on uppP catalytic mechanism?

Site-directed mutagenesis studies have provided valuable insights into the catalytic mechanism of uppP:

MutationEffect on ActivityMechanistic Implication
E21ANo significant difference from wild-typeE17 may compensate for E21 function
S26AVery weak phosphatase activityS26 contributes to catalysis but can be partially compensated by S27
S27AVery weak phosphatase activityS27 is important but not absolutely essential due to partial compensation by S26
S26A/S27ANo detectable activityBoth serine residues are required for catalysis
R174ANo detectable activityR174 is critical for generating the phosphoenzyme intermediate
S26A/R174ANo detectable activityConfirms the essential role of R174

These findings suggest a catalytic mechanism where E21 (potentially with E17) activates S27, which initiates a nucleophilic attack on the terminal phosphate of C55-PP. R174 plays a critical role in generating the phosphoenzyme intermediate, and its mutation completely abolishes activity . Understanding this mechanism provides opportunities for rational design of uppP inhibitors as potential antibiotics.

How can real-time monitoring techniques advance our understanding of uppP function?

Real-time monitoring techniques, particularly native mass spectrometry, offer unprecedented insights into the dynamics of uppP-catalyzed reactions. This approach allows:

  • Direct observation of enzyme-substrate complexes and their conversion to enzyme-product complexes over time

  • Monitoring reaction progress without the need for indirect assays or labels

  • Quantification of binding affinities for different substrates under identical conditions

  • Detection of transient intermediates during catalysis

  • Evaluation of inhibitor binding and mechanisms of inhibition

The methodology involves releasing protein ions from a buffer containing 200 mM ammonium acetate (pH 8.0) and 0.05% LDAO, then recording spectra as a function of incubation time . The transition from micellar solution to gas phase effectively quenches the reaction, providing time-resolved snapshots of the catalytic process. By manipulating reaction conditions, such as adding 20 μM EDTA to decrease divalent cation concentration, researchers can slow down the reaction to capture fast processes .

This approach has successfully demonstrated the processing of C15-PP and C55-PP by uppP, revealing differences in substrate binding and processing rates. For example, with C15-PP, enzyme-substrate complexes are detectable at 30 seconds, with product formation observed after approximately 1 minute. In contrast, C55-PP processing occurs more rapidly, requiring the addition of EDTA to capture the enzyme-substrate complex .

What is the relationship between uppP and antibiotic resistance?

UppP (also known as BacA) plays a significant role in antibiotic resistance, particularly against antibiotics that target cell wall biosynthesis. The enzyme's function in dephosphorylating undecaprenyl pyrophosphate is critical for recycling the lipid carrier during peptidoglycan synthesis, making it a target for antibiotics like bacitracin and teixobactin .

Recent research using real-time biosynthetic reaction monitoring has demonstrated how these antibiotics inhibit uppP activity, providing mechanistic insights into their mode of action . Bacitracin is known to bind to undecaprenyl pyrophosphate, preventing its dephosphorylation by uppP, while teixobactin has been shown to interact with multiple lipid II cycle intermediates. Understanding these inhibition mechanisms is crucial for developing new strategies to combat antibiotic resistance.

Research approaches to study uppP's role in antibiotic resistance include:

  • Comparative genomics to identify variations in uppP across resistant strains

  • Structure-activity relationship studies of inhibitors

  • Combination therapy approaches targeting multiple steps in peptidoglycan biosynthesis

  • Development of uppP activity assays for high-throughput screening of novel inhibitors

What are the challenges in working with recombinant membrane phosphatases like uppP?

Working with membrane phosphatases such as uppP presents several technical challenges:

  • Expression and solubilization: As integral membrane proteins, uppP enzymes are difficult to express at high levels and require detergents for solubilization without compromising their structure and function .

  • Maintaining native lipid interactions: The functional properties of uppP depend on specific lipid interactions, particularly with phosphatidylethanolamine. Preserving these interactions during purification and analysis requires careful selection of detergents and buffer conditions .

  • Assay development: Traditional phosphatase assays may not accurately reflect the activity of membrane-bound enzymes. Real-time monitoring approaches like native mass spectrometry offer advantages but require specialized equipment and expertise .

  • Substrate availability: The natural substrate C55-PP has limited commercial availability and is challenging to synthesize, leading researchers to use shorter analogs like C15-PP, which may not fully recapitulate native interactions .

  • Expression optimization: Approximately 50% of recombinant proteins fail to express in host cells, requiring optimization strategies like enhancing mRNA accessibility at translation initiation sites .

To address these challenges, researchers have developed specialized approaches including native mass spectrometry for real-time reaction monitoring, computational tools for predicting protein expression success, and the use of model substrates with defined lipid compositions .

How can computational approaches improve recombinant uppP production?

Computational approaches can significantly enhance recombinant uppP production through several strategies:

  • Prediction of expression success: Analysis of mRNA accessibility at translation initiation sites can predict expression outcomes with high accuracy. This approach has been validated using large datasets of recombinant protein expression experiments, demonstrating that the accessibility of translation initiation sites modeled using mRNA base-unpairing across the Boltzmann's ensemble significantly outperforms alternative features .

  • Synonymous codon optimization: Tools like TIsigner use simulated annealing to modify up to the first nine codons of mRNAs with synonymous substitutions, maintaining the amino acid sequence while enhancing expression levels. This approach capitalizes on the finding that accessibility captures key propensities beyond the target region, allowing a modest number of synonymous changes to tune recombinant protein expression levels .

  • Stochastic simulation modeling: Computational models can predict how higher accessibility leads to higher protein production and slower cell growth, allowing researchers to balance expression levels and host cell viability. These models account for factors such as plasmid copy number, mRNA stability, translation efficiency, and protein toxicity thresholds .

  • Structure-based design: Computational analysis of protein structure can identify potential stabilizing mutations or optimal purification tags that minimize interference with protein folding and function.

The application of these computational approaches to uppP expression could significantly improve yields and functional quality of the recombinant protein, facilitating structural and functional studies of this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.