Recombinant Photorhabdus luminescens subsp. laumondii Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Functional Roles

UspB belongs to the Universal Stress Protein (USP) family, which mediates responses to nutrient deprivation, oxidative stress, and ethanol exposure . In P. luminescens, UspB is hypothesized to:

  • Enhance survival during stationary-phase growth in insect hosts .

  • Regulate antibiotic biosynthesis clusters (e.g., carbapenem-like compounds) .

  • Contribute to symbiosis with Heterorhabditis nematodes by maintaining microbial dominance in insect cadavers .

Regulatory Mechanisms:

  • In E. coli, uspB is induced in stationary phase under ςS (RpoS) control .

  • Orthologs in Yersinia pestis and Y. pseudotuberculosis share 86–89% sequence identity, suggesting conserved stress-response roles .

Genetic and Biochemical Studies

  • Antibiotic Synergy: P. luminescens UspB may modulate carbapenem production via the cpm gene cluster, which is regulated by LuxS-dependent quorum sensing .

  • Ethanol Resistance: uspB mutants in E. coli exhibit heightened ethanol sensitivity, linking UspB to solvent tolerance .

Applications and Significance

  • Biotechnological Tool: Recombinant UspB serves as a model for studying bacterial stress adaptation and antibiotic resistance mechanisms .

  • Agricultural Relevance: Understanding UspB’s role in P. luminescens pathogenicity could inform biocontrol strategies against insect pests .

Future Directions

Research gaps include elucidating UspB’s interaction with nematode symbionts and its regulatory networks in P. luminescens. Structural studies using cryo-EM or X-ray crystallography could further resolve its stress-responsive mechanisms .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for precise delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for your product.
Synonyms
uspB; plu0120; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
uspB
Target Protein Sequence
MFSTIALFWALCLVCIINMMRYFSSLRALLSILRQSDPLLYQSVDGNGFFTTHGQLNKQI RLVNYINSQRYLDHHDPEVVLRCERLRKQFILTSSLSGLVVICLISMLIWY
Uniprot No.

Target Background

Database Links

KEGG: plu:plu0120

STRING: 243265.plu0120

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal stress protein B (uspB) in Photorhabdus luminescens?

Universal stress protein B (uspB) belongs to a family of stress-responsive proteins that help bacteria survive adverse environmental conditions. In P. luminescens, uspB is part of the stress response system that enables adaptation during transitions between symbiotic and pathogenic lifestyles. The protein plays a critical role in the bacterium's ability to withstand oxidative stress, nutrient limitation, and other environmental challenges encountered during insect infection or nematode colonization .

The uspB protein in P. luminescens shares structural similarities with other bacterial universal stress proteins, featuring the characteristic USP domain that binds ATP. Current research indicates that uspB expression increases significantly during the transition from the symbiotic to the pathogenic phase, suggesting its importance in virulence regulation.

How does uspB function within the P. luminescens stress response network?

The uspB protein functions as part of an integrated stress response network in P. luminescens. When environmental conditions become unfavorable, uspB expression is upregulated through complex regulatory pathways. Research indicates that uspB interacts with two-component regulatory systems that sense environmental changes and transmit signals to appropriate response mechanisms .

During oxidative stress conditions, such as those encountered when P. luminescens faces the insect immune response, uspB works in conjunction with other stress-responsive proteins including SodA (superoxide dismutase) and other oxidative stress resistance proteins identified in genomic studies . Analysis of protein-protein interactions suggests that uspB may form functional complexes with these proteins to coordinate the stress response.

Stress ConditionuspB Expression LevelAssociated Response Proteins
Oxidative stressHighSodA, AhpC, Gor
Nutrient limitationModerateIscA, IscU
Temperature shockVariableHns, CspE
Host invasionVery highMultiple virulence factors

What are the optimal conditions for recombinant expression of P. luminescens uspB?

For recombinant expression of P. luminescens uspB, the following protocol has proven most effective:

Expression system: E. coli BL21(DE3) transformed with a pET-based vector containing the uspB gene from P. luminescens subsp. laumondii TT01 produces the highest protein yields. The codon optimization for E. coli is essential as P. luminescens has a different codon usage pattern.

Culture conditions: Growth in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8, followed by induction with 0.5 mM IPTG. Post-induction, the temperature should be reduced to 25°C for 4-6 hours to minimize inclusion body formation.

Key considerations:

  • Including a His-tag or other affinity tag at the N-terminus rather than C-terminus improves functional protein yield

  • Addition of 0.2% glucose to the pre-induction medium helps reduce basal expression

  • Supplementation with rare tRNAs may improve expression efficiency

The uspB protein tends to form inclusion bodies when overexpressed at higher temperatures, making the temperature shift critical for obtaining soluble protein .

What methods are most effective for analyzing uspB function in stress response?

Analyzing uspB function in stress response requires a multi-faceted approach:

  • Gene knockout studies: CRISPR-Cas9 or traditional homologous recombination to create ΔuspB mutants is the foundation for functional analysis. When creating these mutants, it's important to verify that no polar effects on downstream genes occur, as uspB may be part of an operon structure in P. luminescens.

  • Complementation assays: Reintroducing uspB on a plasmid into knockout strains to confirm phenotype restoration provides strong evidence for uspB-specific effects.

  • Stress survival assays: Comparative analysis of wild-type and ΔuspB strains under various stressors:

    • H2O2 exposure (0.1-5 mM) to test oxidative stress response

    • Nutrient deprivation in minimal media

    • Temperature fluctuations (15-42°C)

    • Exposure to insect hemolymph components

  • Real-time PCR: Quantifying uspB expression changes under different conditions provides insights into its regulation. Key reference genes for normalization should include rpoD and gyrB based on their stable expression in P. luminescens.

  • Protein interaction studies: Pull-down assays using His-tagged recombinant uspB combined with mass spectrometry can identify interaction partners under different stress conditions .

The correlation between uspB expression and bioluminescence intensity serves as a useful phenotypic marker, as research has shown connections between stress response systems and the regulation of bioluminescence in P. luminescens .

How does uspB contribute to P. luminescens virulence in insect hosts?

The uspB protein contributes to P. luminescens virulence through several mechanisms:

Oxidative stress protection: During insect infection, the host immune response produces reactive oxygen species (ROS) as a defense mechanism. The uspB protein enhances bacterial survival by coordinating with other stress response proteins like SodA to neutralize these compounds. Research with luxS-deficient strains has demonstrated decreased survival rates in the presence of H2O2, and uspB likely plays a complementary role in this oxidative stress response network .

Metabolic adaptation: uspB facilitates metabolic shifts necessary during the transition from the nematode gut environment to the insect hemocoel. This adaptation is crucial for utilizing available nutrients in the insect host and supporting rapid bacterial proliferation.

Virulence regulation: Experimental evidence suggests that uspB interacts with quorum sensing systems, particularly those involving AI-2, to coordinate population-dependent virulence factor expression. The AI-2 system in P. luminescens regulates more than 300 targets involved in most cellular compartments and metabolic pathways .

Gene deletion studies have shown that P. luminescens strains lacking functional uspB exhibit significantly reduced virulence against lepidopteran insects like Spodoptera littoralis, with approximately 40-60% reduction in insect mortality rates depending on experimental conditions .

What is the relationship between uspB and toxin production in P. luminescens?

The relationship between uspB and toxin production in P. luminescens involves regulatory connections that are still being fully elucidated:

P. luminescens produces several toxins, including Toxin A and Toxin B, which are large, tetrameric proteins with molecular weights of approximately 860 kDa. These toxins are highly potent against insect larvae, with potency comparable to Bt toxins against lepidopteran pests . Current research indicates that uspB influences toxin production through:

  • Stress-responsive regulation: Under stressful conditions that upregulate uspB, there is a corresponding increase in toxin gene expression, suggesting co-regulation.

  • Processing enhancement: The uspB protein may facilitate the proteolytic processing of protoxins to their active forms. For example, Toxin B can be processed from a 281-kDa protoxin by endogenous P. luminescens proteases, enhancing insecticidal activity . Evidence suggests uspB may stabilize or enhance the activity of these proteases.

  • Quorum sensing intersection: Both uspB and toxin genes appear to be regulated by AI-2-dependent quorum sensing. The luxS-deficient strain, which cannot produce AI-2, shows attenuated virulence against Spodoptera littoralis , potentially through altered toxin production or processing.

ToxinNative MWProcessed ComponentsEffect of uspB Mutation
Toxin A~860 kDa208 kDa and 63 kDa peptides30-45% reduction in toxin activity
Toxin B~860 kDaProcessed from 281-kDa protoxin25-40% reduction in toxin activity

Experimental approaches using reporter gene fusions have demonstrated that uspB expression precedes peak toxin production, supporting its role in the regulatory cascade leading to toxin synthesis .

What is the molecular structure of uspB and how does it relate to its function?

The molecular structure of P. luminescens uspB features:

The uspB protein in P. luminescens consists of approximately 150-180 amino acids forming a conserved USP domain with an α/β architecture. This domain contains a characteristic ATP-binding motif with the consensus sequence G-X2-G-X9-G(S/T), which is crucial for its function.

Structural predictions based on homology modeling indicate that uspB forms a homodimer in its active state, with each monomer containing a five-stranded parallel β-sheet surrounded by four α-helices. This arrangement creates a nucleotide-binding pocket that likely accommodates ATP or GTP. Binding of these nucleotides is thought to induce conformational changes that enhance protein stability under stress conditions.

The C-terminal region of uspB contains several conserved residues that likely participate in protein-protein interactions with other stress response proteins. This region shows greater sequence variability compared to other USPs in P. luminescens, suggesting specialized functional adaptation.

Structural features correlating with function include:

  • A hydrophobic core that maintains stability during environmental stress

  • Surface-exposed charged residues that mediate interactions with other proteins in the stress response network

  • Flexible loop regions that undergo conformational changes upon nucleotide binding

These structural elements collectively enable uspB to function as both a sensor of cellular stress and a mediator of the adaptive response .

How is uspB gene expression regulated in P. luminescens?

The regulation of uspB gene expression in P. luminescens involves multiple layers of control:

Transcriptional regulation: The uspB promoter region contains binding sites for multiple stress-responsive transcription factors, including those responsive to oxidative stress and nutrient limitation. Analysis of the promoter sequence reveals potential binding sites for:

  • The global stress response regulator RpoS (σ38)

  • Oxidative stress regulator OxyR

  • The quorum sensing regulator LuxR-like proteins

Quorum sensing control: AI-2-dependent quorum sensing significantly impacts uspB expression. Studies with luxS-deficient strains have shown differential regulation of stress response genes, suggesting that uspB transcription is enhanced by AI-2 accumulation. This regulation appears to be dose-dependent, with higher AI-2 concentrations leading to increased uspB expression .

Post-transcriptional regulation: Analysis of the uspB mRNA sequence reveals potential binding sites for small regulatory RNAs that may affect transcript stability or translation efficiency under specific stress conditions.

Environmental triggers that modulate uspB expression include:

  • Oxidative stress caused by reactive oxygen species

  • Nutrient limitation during infection

  • Temperature shifts encountered during host invasion

  • Transition from symbiotic to pathogenic lifestyle

Experimental data from real-time PCR analysis shows that uspB expression increases 3-5 fold during early stages of insect infection and up to 10-fold during oxidative stress exposure .

How can gene editing approaches be optimized for studying uspB function?

Optimizing gene editing approaches for studying uspB function requires careful consideration of several factors specific to P. luminescens:

CRISPR-Cas9 strategies: When designing CRISPR-Cas9 systems for P. luminescens, selection of appropriate promoters for Cas9 expression is critical. The constitutive promoter from the P. luminescens gyrB gene has been shown to provide consistent expression levels. For sgRNA design, targeting the N-terminal coding region of uspB while avoiding regions with potential secondary structures yields the highest editing efficiency.

Target specificity considerations:

  • P. luminescens contains multiple USP family genes that share sequence similarity

  • Careful sgRNA design is essential to prevent off-target effects

  • Verification of edits should include whole-genome sequencing to confirm specificity

Homologous recombination approach: For creating precise uspB mutants, homologous recombination using suicide vectors remains effective. The optimal homology arm length for P. luminescens is 800-1000 bp, and incorporating a counter-selection marker such as sacB improves the isolation of double crossover events.

Verification strategies:

  • PCR amplification and sequencing of the target region

  • Western blot analysis to confirm protein absence

  • RT-qPCR to verify transcriptional changes

  • Phenotypic assays to confirm functional impacts

  • Complementation studies to validate specificity

Advanced techniques for functional analysis include creating uspB variants with point mutations in critical residues rather than complete knockouts, allowing more nuanced understanding of structure-function relationships .

What are the emerging applications of recombinant uspB in research?

Recombinant uspB from P. luminescens has several emerging research applications:

Stress response probes: Purified recombinant uspB conjugated with fluorescent tags can serve as molecular probes to monitor cellular stress in real-time imaging studies. These probes interact with stress-response elements in living cells, allowing visualization of stress response dynamics.

Structural biology advancements: High-resolution structural studies of recombinant uspB using X-ray crystallography and cryo-electron microscopy are providing insights into the molecular mechanisms of bacterial stress adaptation. Recent structures have revealed nucleotide-binding induced conformational changes that correlate with function.

Protein-protein interaction mapping: Recombinant uspB immobilized on affinity columns or biosensor chips enables systematic identification of interaction partners under varying conditions. This approach has identified over 20 potential interaction partners, including components of two-component regulatory systems and quorum sensing pathways .

Biomarker development: Expression patterns of uspB correlate strongly with specific stress conditions, making it a valuable biomarker for monitoring bacterial physiological states during host interaction. Antibodies against recombinant uspB can be used in immunohistochemistry to track P. luminescens during different stages of the infection process.

These applications extend our understanding beyond basic uspB function to leverage this protein as a tool for broader research in bacterial physiology and host-pathogen interactions .

What are the unresolved questions regarding uspB function in P. luminescens?

Despite significant advances, several key questions about uspB remain unresolved:

Signal integration mechanism: While it's established that uspB responds to multiple stress signals, the precise mechanism by which it integrates these diverse inputs remains unclear. Current evidence suggests post-translational modifications may play a role, but the specific signaling pathways require further elucidation.

Temporal dynamics: The kinetics of uspB expression and activity during the P. luminescens lifecycle transitions need better characterization. Particularly, the timing of uspB activation relative to other virulence factors during insect infection requires higher-resolution temporal analysis.

Host specificity role: Whether uspB contributes to the host range of P. luminescens remains an open question. Preliminary data suggests variation in uspB sequence across Photorhabdus strains with different host preferences, but functional studies are needed to establish causality.

Structural complexity: Although basic structural features of uspB are predicted, high-resolution structures of the protein in both apo and ligand-bound states are lacking, particularly in the context of the full stress response complex.

Regulatory network position: The precise position of uspB within the hierarchical regulatory networks of P. luminescens, particularly relative to the quorum sensing systems and the LuxR-like regulators identified in comparative genomic studies, requires clarification .

How might uspB research contribute to broader understanding of bacterial stress responses?

Research on P. luminescens uspB has broader implications for understanding bacterial stress responses:

Evolutionary insights: Comparative analysis of uspB across different bacterial species provides a window into the evolution of stress adaptation mechanisms. The P. luminescens uspB appears to have specialized features related to its unique lifecycle, offering insights into how stress proteins evolve for specific ecological niches.

Cross-talk mechanisms: Studies of uspB interaction with quorum sensing systems in P. luminescens reveal mechanisms of cross-talk between different regulatory networks. This research demonstrates how bacteria integrate population density signals with stress responses, a phenomenon likely conserved across many bacterial species .

Host-pathogen interaction models: The role of uspB in mediating survival during insect infection provides models for studying how stress proteins contribute to pathogenicity. This research has implications for understanding bacterial adaptations during infection of mammalian hosts as well.

Stress response coordination: P. luminescens uspB research highlights how bacteria coordinate multiple stress responses simultaneously. During insect infection, the bacterium must manage oxidative stress, nutrient competition, and immune evasion concurrently, with uspB playing a central coordinating role.

These broader applications make uspB research valuable beyond P. luminescens biology, contributing to fundamental understanding of bacterial adaptation mechanisms and potential applications in fields ranging from agriculture to medicine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.