Recombinant Photorhabdus luminescens subsp. laumondii UPF0283 membrane protein plu2581 (plu2581)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
plu2581; UPF0283 membrane protein plu2581
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
plu2581
Target Protein Sequence
MTEPLKPRIDFAESLSGPQEPVLKPAQIFNEKETANFCPASPELEAEEREGQVEGIVNAA LKPKRSGWRKMVYGSLMLLGLSAVAQFVQWIYQSWQQQDWSALGVAAAGSMIVFAGIGSL VSEWHRLYRLRVRSEERDTARALLQHHGVGKGREFCEKLASQAGIEQHNPALQRWRAALH DTHNDREVVVLYSKWVQPVLDSQVRAEISRCAAESALMIAVSPLAIVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIVFSGASEVVREVGMDWLSQDIAARLSVRAAQGI GVGLLTARLGIKAMELCRPLPWIEGDKPKLGDFRRQLITQLKNILPNKSKNIVN
Uniprot No.

Target Background

Database Links

KEGG: plu:plu2581

STRING: 243265.plu2581

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Photorhabdus luminescens subsp. laumondii UPF0283 membrane protein plu2581?

Photorhabdus luminescens subsp. laumondii UPF0283 membrane protein plu2581 (UniProt ID: Q7N3Y1) is a membrane protein from the bacterium Photorhabdus luminescens strain TT01. It belongs to the UPF0283 protein family, which consists of uncharacterized membrane proteins. The full-length protein contains 354 amino acids and appears to have multiple transmembrane domains based on its sequence characteristics .

What are the recommended storage conditions for recombinant plu2581?

For optimal stability and activity of recombinant plu2581:

  • Store the protein at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Lyophilized protein should be reconstituted in an appropriate buffer

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this may compromise protein integrity

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol

What expression systems are available for producing recombinant plu2581?

Multiple expression systems are available for producing recombinant plu2581, each with specific advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications
YeastBetter folding for complex proteins, some post-translational modificationsLonger production time
Mammalian cellsAuthentic post-translational modifications, proper foldingMost expensive, lower yields
Insect cellsHigh expression levels, post-translational modificationsModerate cost, specialized equipment needed

The choice of expression system should be based on the specific research requirements, including the need for post-translational modifications and protein folding considerations .

What tags are commonly used for recombinant plu2581 expression and purification?

Various fusion tags can be employed to facilitate expression, purification, and detection of recombinant plu2581:

Tag TypePurposePosition Options
His TagMetal affinity purificationN-terminal or C-terminal
FLAG TagImmunoaffinity purification, detectionN-terminal or C-terminal
MBPSolubility enhancement, purificationTypically N-terminal
GSTSolubility enhancement, purificationTypically N-terminal
GFPVisualization, localization studiesTypically C-terminal
BiotinInteraction studiesN-terminal or C-terminal

The tag type will be determined during the production process based on specific research needs. For membrane proteins like plu2581, tag position can significantly affect protein folding and functionality .

How should researchers design experiments to study plu2581 membrane localization?

When designing experiments to study plu2581 membrane localization, consider the following methodological approach:

  • Fluorescent Tagging Strategy:

    • Use C-terminal GFP fusion constructs to minimize disruption of membrane insertion

    • Compare results with N-terminal tagging to identify potential artifacts

    • Include wild-type controls to assess tag interference

  • Subcellular Fractionation Protocol:

    • Employ differential centrifugation to isolate membrane fractions

    • Verify fractionation quality using known membrane protein markers

    • Quantify protein distribution using immunoblotting with tag-specific antibodies

  • Microscopy Validation:

    • Implement confocal microscopy to visualize protein localization

    • Calculate the PM-to-intracellular ratio of fluorescent signals

    • Compare pixel intensity between compartments for quantitative assessment

  • Controls and Validation:

    • Include wild-type and knockout controls in all experiments

    • Use multiple complementary approaches to confirm localization

    • Consider using protease protection assays to determine topology

What methods are appropriate for studying potential functions of plu2581?

To investigate the potential functions of this uncharacterized membrane protein, implement a structured functional analysis approach:

  • Comparative Genomics Analysis:

    • Identify homologs in related species

    • Examine genomic context for functional associations

    • Search for conserved domains that might suggest function

  • Gene Deletion Studies:

    • Generate knockout mutants using CRISPR-Cas9 or homologous recombination

    • Perform comprehensive phenotypic characterization

    • Compare growth rates under various conditions

  • Protein-Protein Interaction Analysis:

    • Conduct pull-down assays using tagged recombinant protein

    • Perform yeast two-hybrid or bacterial two-hybrid screens

    • Validate interactions using co-immunoprecipitation

  • Membrane Transport Assays:

    • Test for potential transport activity using liposome reconstitution

    • Measure ion flux or substrate transport in controlled conditions

    • Compare activity with known membrane transporters

How can researchers address potential contradictions in plu2581 functional data?

When confronting contradictory findings in plu2581 functional studies, implement a systematic contradiction resolution framework:

  • Parameterized Contradiction Analysis:

    • Apply the (α, β, θ) notation system to classify contradictions

    • Identify the number of interdependent items (α)

    • Determine contradictory dependencies defined by domain experts (β)

    • Calculate minimal required Boolean rules to assess contradictions (θ)

  • Experimental Design Revaluation:

    • Examine variations in experimental conditions

    • Identify confounding variables that may explain contradictions

    • Design controlled experiments that specifically address contradictory findings

  • Multi-Method Validation:

    • Employ complementary methodological approaches

    • Compare in vitro and in vivo results

    • Use different expression systems to rule out artifact-based contradictions

  • Data Integration Strategy:

    • Implement Bayesian analysis to weigh contradictory evidence

    • Develop weighted confidence scores for different experimental approaches

    • Consider publication bias in literature-derived contradictions

What considerations are important when designing experiments to study potential phase variations in plu2581 expression?

Phase variation is an important regulatory mechanism in bacteria. When investigating potential phase variation in plu2581 expression, consider the following methodological framework:

  • Sequence Analysis for Phase Variation Mechanisms:

    • Examine the promoter and upstream regions for repetitive elements

    • Identify potential slipped-strand mispairing sites

    • Search for inverted repeats that might indicate recombination-based switching

  • Single-Cell Expression Analysis:

    • Implement fluorescent reporter fusions to monitor expression

    • Use flow cytometry to quantify population heterogeneity

    • Perform time-lapse microscopy to track switching events

  • Genetic Stability Assessment:

    • Monitor sequence changes in populations over multiple generations

    • Measure switching frequencies under different environmental conditions

    • Identify environmental triggers that influence phase variation rates

  • Transcription Termination Analysis:

    • Examine potential formation of stem-loop structures

    • Test for premature transcription termination

    • Investigate ribosome-mediated transcription attenuation mechanisms

How can researchers design experiments to study plu2581's potential role in bacterial-host interactions?

When investigating the potential involvement of plu2581 in bacterial-host interactions, employ the following methodological approach:

  • Expression Pattern Analysis:

    • Monitor plu2581 expression levels during different phases of host interaction

    • Compare expression between free-living and host-associated bacterial populations

    • Identify host factors that might trigger expression changes

  • Mutant Phenotype Characterization:

    • Generate plu2581 deletion and overexpression mutants

    • Assess mutant ability to colonize hosts compared to wild-type

    • Measure bacterial persistence in different host tissues

  • Host Response Analysis:

    • Compare host immune responses to wild-type and plu2581 mutant bacteria

    • Measure inflammatory markers and immune cell recruitment

    • Assess potential epithelial barrier disruption

  • Protein Localization During Infection:

    • Track plu2581 localization during different stages of host interaction

    • Determine if the protein redistributes during host cell contact

    • Identify potential host cell targets using proximity labeling approaches

What are the key quality control parameters for recombinant plu2581?

To ensure high-quality recombinant plu2581 for research applications, implement the following quality control measures:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE>80-95% depending on application
IdentityMass spectrometryMatch to theoretical mass
Tag presenceWestern blotPositive signal with tag-specific antibody
Secondary structureCircular dichroismConsistent with membrane protein profile
Aggregation stateSize exclusion chromatographyMinimal aggregation
Endotoxin levelLAL assay<1 EU/mg for cell-based assays
Batch-to-batch variationFunctional assays<15% variation between batches

For membrane proteins like plu2581, additional tests for proper folding and membrane insertion may be necessary to ensure biological relevance of experimental results .

How can researchers address common challenges in membrane protein studies when working with plu2581?

When working with membrane proteins like plu2581, researchers should anticipate and address these common challenges:

  • Solubility and Aggregation Issues:

    • Optimize detergent type and concentration for extraction

    • Consider using amphipols or nanodiscs for stabilization

    • Test different buffer compositions to improve solubility

  • Expression Level Optimization:

    • Adjust induction conditions (temperature, inducer concentration)

    • Test different promoter strengths

    • Consider specialized expression strains for membrane proteins

  • Purification Challenges:

    • Implement two-step purification strategies

    • Optimize detergent exchange during purification

    • Use size exclusion chromatography as a final polishing step

  • Functional Assay Development:

    • Design liposome reconstitution protocols

    • Develop activity assays based on predicted function

    • Include appropriate positive and negative controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.