Recombinant Photorhabdus luminescens subsp. laumondii UPF0299 membrane protein plu1549 (plu1549)

What is the structure and function of Photorhabdus luminescens UPF0299 membrane protein plu1549?

The UPF0299 membrane protein plu1549 is a 145-amino acid protein encoded by the plu1549 gene in Photorhabdus luminescens subspecies laumondii (strain TT01). The protein has the following amino acid sequence: MSFREVLIVGWQYLRAFVLIYLCLLTGNAISSLLPIIIPCSIIGMLILFVLLAFQLIPAHWAKPGCSLLLKNMTLLFLPIGVGVMNYYDQLSQQIIPIVFSCLISTAIVMIIVAYSSHYVHRERPIVGSTSEINNEQQKQEKQEK .

Based on its amino acid composition and predicted structure, plu1549 is classified as a membrane protein, suggesting it plays a role in cellular membrane functions. The protein's exact biological function remains to be fully characterized, but as a membrane protein, it likely participates in processes such as cell signaling, transport, or membrane integrity.

What expression systems are most suitable for producing recombinant plu1549 protein?

While specific data for plu1549 expression is limited, research on recombinant protein expression from Photorhabdus luminescens provides valuable guidance. Escherichia coli remains the predominant expression system for Photorhabdus proteins, particularly strain BL21, as demonstrated in complementation assays with related Photorhabdus proteins .

For membrane proteins like plu1549, consider these expression system options:

Success rates for recombinant protein expression in E. coli systems are approximately 50%, with membrane proteins presenting additional challenges compared to soluble proteins . Careful optimization of expression conditions is essential for success.

How should recombinant plu1549 be stored for optimal stability?

For optimal stability of recombinant plu1549, store the protein at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, conservation at -80°C is recommended .

To maintain protein integrity:

• Avoid repeated freeze-thaw cycles

• Prepare working aliquots and store at 4°C for up to one week

• When thawing frozen stock, do so gradually on ice to prevent protein degradation

These storage recommendations follow standard protocols for membrane proteins, which are particularly sensitive to denaturation during handling and storage processes.

What strategies can improve expression yield of recombinant plu1549 in E. coli systems?

Improving expression yield of membrane proteins like plu1549 requires targeted optimization approaches. Analysis of 11,430 recombinant protein expression experiments reveals that translation initiation site accessibility is a critical determinant of expression success .

Key optimization strategies:

• Enhance translation initiation site accessibility: Modify the first 9 codons with synonymous substitutions to reduce mRNA secondary structure at the translation initiation site. This approach has been shown to improve expression levels with minimal sequence changes (as few as 2 nucleotide changes compared to 187-241 for commercial optimization) .

• Optimize expression temperature: Expression at lower temperatures (16-25°C) often improves membrane protein folding and reduces aggregation.

• Adjust induction conditions: For membrane proteins, lower inducer concentrations and longer expression times may improve yield and quality.

• Expression vector selection: Consider vectors with regulatable promoters that allow fine-tuning of expression levels.

The TIsigner tool, which optimizes accessibility through simulated annealing to modify the first nine codons of mRNAs with synonymous substitutions, has proven effective for increasing protein yields across diverse species .

How can one distinguish between properly folded and misfolded recombinant plu1549?

Distinguishing properly folded from misfolded recombinant membrane proteins like plu1549 requires multiple analytical approaches:

When expressing membrane proteins like plu1549, it's important to note that high expression levels often correlate with increased production of insoluble protein. This phenomenon was observed with recombinant RLuc protein, where higher expression led to significant aggregation issues as detected by SDS-PAGE analysis . Similar challenges may occur with plu1549, necessitating careful balancing of expression optimization with protein quality assessment.

What is the relationship between plu1549 and other membrane proteins from Photorhabdus luminescens involved in toxin function?

While the specific relationship between plu1549 and toxin-related proteins hasn't been directly established in the provided search results, insights can be gained from other Photorhabdus luminescens membrane proteins.

Photorhabdus luminescens produces toxins that exhibit membrane-permeabilizing activity in insect cells. For instance, the PL toxin induces channel formation in midguts of Manduca sexta and Tenebrio molitor, causing permeability changes in brush border membrane vesicles (BBMVs) . Other membrane-associated proteins like Pdl1 enhance toxin secretion and release from the bacterial surface .

Research questions to explore include:

• Does plu1549 interact with known toxin complexes?

• Is plu1549 involved in toxin secretion mechanisms similar to Pdl1?

• Could plu1549 participate in membrane permeabilization processes?

Experimental approaches might include co-immunoprecipitation studies, bacterial two-hybrid assays, or complementation experiments using plu1549 knockout strains.

What purification methods are most effective for recombinant plu1549?

Based on knowledge of membrane protein purification and information about related Photorhabdus proteins, the following purification strategy is recommended:

• Membrane fraction isolation:

  • Harvest cells and disrupt by sonication or French press

  • Remove cell debris by low-speed centrifugation

  • Isolate membrane fraction via ultracentrifugation (100,000 × g)

• Detergent screening:
  Test multiple detergents for extraction efficiency:

  Detergent	Concentration Range	Comments
  DDM	0.5-2%	Mild, widely used for membrane proteins
  LDAO	0.5-1%	Effective for many bacterial membrane proteins
  Triton X-100	0.5-2%	Good solubilizing power, may affect structure

• Affinity chromatography:

  • Use His-tag affinity if expression construct includes a histidine tag

  • Consider using immobilized metal affinity chromatography (IMAC)

• Size exclusion chromatography:

  • For final polishing and buffer exchange

  • Allows assessment of protein homogeneity

The specific tag type for commercially available recombinant plu1549 is determined during the production process , so purification protocols may need adjustment based on the specific construct used.

How can researchers troubleshoot low expression levels of recombinant plu1549?

When encountering low expression levels of recombinant plu1549, consider this systematic troubleshooting approach:

• Evaluate translation initiation site accessibility:

  • Calculate the opening energy of the mRNA secondary structure around the start codon

  • Consider redesigning the construct with optimized accessibility if values exceed 10 kcal/mol

  • The TIsigner tool can be used to optimize accessibility by modifying the first 9 codons

• Examine expression vector and host strain compatibility:

  • Test alternative E. coli strains specialized for membrane protein expression

  • Consider switching to a vector with a different promoter strength

• Optimize induction parameters:

  • Test a range of inducer concentrations (e.g., 0.01-1.0 mM IPTG)

  • Vary induction temperature (16°C, 25°C, 30°C)

  • Adjust induction duration (4h, 8h, overnight)

• Assess protein toxicity:

  • Monitor cell growth after induction

  • Consider using tightly regulated expression systems for toxic proteins

Analysis of PSI:Biology expression experiments shows that approximately 50% of recombinant proteins fail to express in host cells, with membrane proteins being particularly challenging . Troubleshooting should be approached systematically, with careful documentation of each condition tested.

What analytical methods can characterize the membrane insertion of plu1549?

Characterizing membrane insertion of plu1549 requires specialized techniques:

• Protease protection assays:

  • Treat intact membrane vesicles with proteases

  • Analyze protected fragments by mass spectrometry

  • Map topology based on accessible vs. protected regions

• Fluorescence-based approaches:

  • Introduce single cysteine residues at different positions

  • Label with environment-sensitive fluorophores

  • Measure fluorescence changes in different membrane environments

• Membrane fractionation:

  • Separate inner and outer membranes using sucrose gradient ultracentrifugation

  • Identify plu1549 localization through immunoblotting

  • This approach has been successful for other Photorhabdus membrane proteins

• Cryo-electron microscopy:

  • Direct visualization of protein in membrane environments

  • Requires specialized equipment and expertise

These methods can provide complementary information about the topology, orientation, and membrane localization of plu1549.

What experimental systems can be used to study plu1549 function in insect models?

To study plu1549 function in insect models, researchers can adapt approaches used for other Photorhabdus luminescens proteins:

• Oral bioassays with Manduca sexta:

  • Feed larvae with recombinant plu1549 or bacteria expressing the protein

  • Monitor larval weight gain over 7 days as an indicator of toxicity

  • Compare results to known toxins as positive controls

  • This approach has been validated for other Photorhabdus proteins

• Brush border membrane vesicle (BBMV) permeability assays:

  • Isolate BBMVs from insect midguts (e.g., Manduca sexta, Tenebrio molitor)

  • Assess membrane permeabilization using fluorescent dyes

  • Compare with known channel-forming toxins like Cry1Ac

• Voltage clamping assays:

  • Use dissected midguts from model insects

  • Measure electrical properties to detect channel formation

  • This technique successfully detected channel formation by PL toxin

• Liposome permeabilization assays:

  • Create large unilamellar vesicles (LUVs) with insect phospholipid compositions

  • Measure calcein release as an indicator of membrane permeabilization

  • Compare effectiveness across different pH conditions

Experimental data from related Photorhabdus proteins shows that channel formation effects can vary significantly between different insect species, with some proteins showing greater activity against Tenebrio molitor than Manduca sexta .

How can complementation assays be designed to study plu1549 function?

Complementation assays can provide valuable insights into plu1549 function by determining whether the protein can rescue phenotypes associated with gene deletion. Based on approaches used for other Photorhabdus proteins , the following design is recommended:

• Generate knockout mutants:

  • Create plu1549 gene deletion mutants using transposon mutagenesis

  • Verify disruption through PCR and sequencing

  • Assess phenotypic changes compared to wild-type

• Construct complementation vectors:

  • Clone wild-type plu1549 gene into an expression vector (e.g., pCDF-1b)

  • Include promoter elements for controlled expression

  • Consider adding epitope tags for detection if they don't interfere with function

• Transform knockout strains:

  • Co-transform E. coli BL21 cells with both knockout cosmid and complementation vector

  • Verify successful transformation by colony PCR and plasmid isolation

  • Culture transformants under appropriate selection

• Functional assessment:

  • Compare phenotypes of wild-type, knockout, and complemented strains

  • Measure relevant parameters (growth characteristics, protein secretion, etc.)

  • Include appropriate controls (empty vector, unrelated gene expression)

This methodology successfully identified the function of Pdl1 in enhancing Photorhabdus toxin complex secretion and could be adapted to elucidate plu1549 function.

How does the accessibility of translation initiation sites affect plu1549 expression?

The accessibility of translation initiation sites is a critical determinant of recombinant protein expression success, including membrane proteins like plu1549. Analysis of 11,430 expression experiments shows that this factor significantly outperforms alternative features in predicting expression outcomes .

Key findings applicable to plu1549 expression:

• Translation initiation site accessibility:

  • Accessibility can be modeled using mRNA base-unpairing across the Boltzmann's ensemble

  • Opening energies correlate strongly with expression success

  • Sub-sequence regions near the start codon show the strongest correlation with expression outcomes

• Optimization approach:

  • Modify only the first 9 codons with synonymous substitutions

  • Target opening energies below 9 kcal/mol for optimal expression

  • A modest number of changes (as few as 2 nucleotides) can significantly improve expression

• Expression-stability trade-off:

  • Higher accessibility leads to higher protein production but may result in slower cell growth

  • This supports the concept of "protein cost," where cell growth is constrained during overexpression

• Experimental validation:

  • TIsigner optimized sequences with lower opening energies consistently show higher expression levels

  • This approach is generalizable across prokaryotic and eukaryotic expression hosts

For plu1549 expression, researchers should calculate the opening energy of the translation initiation site and consider synonymous codon optimization if values indicate poor accessibility.

How does research on plu1549 relate to broader studies of bacterial membrane proteins?

Research on plu1549 connects to broader membrane protein research in several key aspects:

• Protein expression challenges:

  • The ~50% failure rate in recombinant protein expression is consistent across diverse species

  • Membrane proteins like plu1549 face additional challenges related to hydrophobicity and toxicity

  • Learnings from plu1549 expression can inform strategies for other challenging membrane proteins

• Structural biology approaches:

  • Techniques developed for plu1549 purification and characterization can advance membrane protein structural biology

  • Understanding membrane protein topology remains a significant challenge in the field

• Functional characterization:

  • Methods to study plu1549 function can be applied to other bacterial membrane proteins

  • Complementation assays and permeability studies represent widely applicable approaches

• Protein-lipid interactions:

  • Investigating how plu1549 interacts with insect cell membranes contributes to understanding protein-lipid interfaces

  • Voltage clamping and permeability assays provide insights into membrane disruption mechanisms

The methodological approaches developed for plu1549 contribute to the broader toolkit for studying bacterial membrane proteins and their interactions with host systems.

What computational tools are most effective for predicting functional domains in plu1549?

For predicting functional domains in membrane proteins like plu1549, researchers should employ a combination of computational tools:

When analyzing plu1549, pay particular attention to:

• Predicted transmembrane regions that may facilitate membrane insertion

• Conserved motifs shared with other UPF0299 family proteins

• Potential protein-protein interaction sites

• Regions with structural similarity to known membrane-active proteins from Photorhabdus

Computational predictions should be validated experimentally, as the UPF0299 family remains functionally uncharacterized, with limited experimental data available.