Recombinant Photorhabdus luminescens subsp. laumondii Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; plu2577; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Target Names
zntB
Target Protein Sequence
METIYGSSLKEADAVYACQFDGQGGMTPIDMNGVATPVQPFWQHLDYRNPKSYRWLMDTD LLPETVKAGLAGESLRPKIMRTGDGTMITFRTINNSESERPDQLVVFRIYINSQIVISSR HRKVHSLEQVLSDLQNGIGAKTTGHWLVEMVDAITDEVGNFIEDLHDNLIELENMILEQR IPGRGGLALLRKQLIILRRYMAPQRDVFARLASEKLLWMSDEDRYRMQEISDRLGRELDD LDGCIARTAIISDEITSMMADAMNRRTYTMSLLAMIFLPTTFLTGLFGVNLGGIPGNEYY LGFAIFCLLLFGLVLFVAWWLKKSKWL
Uniprot No.

Target Background

Function

Mediates the efflux of zinc ions.

Database Links

KEGG: plu:plu2577

STRING: 243265.plu2577

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its primary function in Photorhabdus luminescens?

ZntB from Photorhabdus luminescens subspecies laumondii is a membrane transporter protein involved in zinc homeostasis. Based on structural homology with related transporters, ZntB functions primarily in the export of zinc ions, helping the bacterium maintain appropriate intracellular zinc concentrations. The protein consists of 327 amino acids and belongs to a family of metal ion transporters that includes the CorA magnesium channel . While ZntB shares structural features with CorA, it has evolved specific mechanisms for zinc transport rather than magnesium transport. In P. luminescens, proper zinc homeostasis is particularly important as this bacterium is a lethal insect pathogen that lives symbiotically with nematodes of the family Heterorhabditidae .

How does the structure of ZntB relate to its transport function?

The structure of ZntB provides critical insights into its transport mechanism. Cryo-electron microscopy studies of the full-length ZntB from Escherichia coli have revealed important structural features that likely apply to the P. luminescens homolog as well . The protein forms a pentameric assembly with a central pore through which zinc ions are transported. Each monomer contains transmembrane domains that anchor the protein in the bacterial membrane and cytoplasmic domains that regulate transport activity. The transport mechanism appears to be driven by proton gradients, suggesting a proton-coupled zinc transport system . Understanding this structure-function relationship is essential for researchers designing experiments to study zinc transport dynamics or developing interventions targeting bacterial metal homeostasis.

What experimental methods are recommended for expressing and purifying recombinant ZntB?

For successful expression and purification of recombinant ZntB from P. luminescens, researchers should consider the following methodology:

  • Expression system: E. coli BL21(DE3) or similar strains optimized for membrane protein expression are recommended.

  • Vector selection: pET-based vectors with appropriate fusion tags (His6, GST, or MBP) can facilitate purification.

  • Expression conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) often improves membrane protein folding.

  • Membrane extraction: Detergent screening is crucial, with commonly effective detergents including n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin.

  • Purification strategy: Immobilized metal affinity chromatography followed by size exclusion chromatography in appropriate detergent micelles.

For functional studies, the protein should be stored in a buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDM, and 50% glycerol at -20°C for short-term storage or -80°C for long-term storage, similar to available commercial preparations .

What techniques are most effective for analyzing ZntB zinc transport activity in vitro?

For quantitative analysis of ZntB-mediated zinc transport activity in vitro, several complementary techniques provide robust data:

  • Radioisotope transport assays: Using 65Zn to directly measure transport kinetics in proteoliposomes reconstituted with purified ZntB. This approach provides the most direct evidence of transport function and can determine key kinetic parameters (Km, Vmax) .

  • Fluorescent zinc indicators: Zinc-sensitive fluorescent probes (FluoZin-3, RhodZin-3) can be encapsulated in liposomes to monitor real-time transport. This technique offers advantages in temporal resolution but requires careful calibration.

  • Isothermal titration calorimetry (ITC): Valuable for determining binding affinities and thermodynamic parameters of zinc interaction with purified ZntB protein. ITC data can complement transport assays to elucidate the relationship between binding and transport .

  • Stopped-flow spectroscopy: Enables measurement of rapid kinetics of conformational changes associated with transport cycles when combined with fluorescent labels.

The integration of multiple techniques allows researchers to develop comprehensive models of ZntB transport mechanisms, including rate-limiting steps and regulatory features.

How can researchers determine the substrate specificity of ZntB compared to other metal transporters?

Determining ZntB substrate specificity requires systematic competitive transport assays and binding studies. Researchers should:

  • Conduct competitive transport assays with radioisotope-labeled zinc (65Zn) in the presence of increasing concentrations of potential competing metal ions (Mg2+, Cd2+, Co2+, Ni2+).

  • Perform ITC experiments with different metal ions to compare binding affinities and thermodynamic signatures.

  • Measure transport rates using reconstituted proteoliposomes exposed to various metal ions at physiologically relevant concentrations.

  • Employ site-directed mutagenesis of predicted metal-coordinating residues to identify determinants of specificity.

When comparing ZntB to its homolog CorA (primarily a magnesium transporter), researchers should note the different coordination chemistry of zinc versus magnesium, which likely influences the metal-binding sites and transport channel properties . Such comparative studies between ZntB and structurally similar transporters provide valuable insights into the evolution of metal specificity in transport proteins.

What structural features distinguish ZntB from other metal transporters like CorA?

  • Metal binding sites: ZntB contains cysteine and histidine residues positioned to coordinate zinc, which prefers tetrahedral coordination geometry, unlike magnesium in CorA that favors octahedral coordination.

  • Transport pathway dimensions: The central pore of ZntB is likely calibrated for the ionic radius of hydrated zinc (approximately 0.74 Å for Zn2+ vs. 0.72 Å for Mg2+), with subtle differences in pore diameter affecting ion selectivity.

  • Gating mechanism: Cryo-EM structures suggest ZntB may utilize a different gating mechanism than CorA, with specific residues in the transmembrane helices controlling zinc passage .

  • Proton coupling: Evidence indicates ZntB utilizes proton gradients to drive zinc transport, unlike CorA which functions primarily as a channel rather than an active transporter .

Understanding these structural distinctions is crucial for researchers investigating the evolutionary adaptations that enable metal ion selectivity in transport proteins and for designing experiments to probe specific functional hypotheses.

Which amino acid residues are critical for zinc binding and transport in ZntB?

Based on structural and functional studies of ZntB and related transporters, several key residues are likely essential for zinc binding and transport:

Functional RolePredicted Critical ResiduesExperimental Evidence
Zinc coordinationHistidine, Cysteine, Aspartate residues in the transport pathwayMutation studies show loss of transport function with substitutions at these positions
Selectivity filterResidues forming the narrowest part of the transport poreAltered ion selectivity observed with mutations in this region
Proton couplingAcidic residues (Glu, Asp) in transmembrane domainsMutations affect pH dependency of transport
GatingConserved residues at the cytoplasmic gateConstitutively open or closed phenotypes when mutated

Researchers investigating these residues should employ site-directed mutagenesis followed by functional assays to determine their precise roles. Conservative and non-conservative substitutions can provide particularly valuable insights into the chemical requirements for each position. Complementary molecular dynamics simulations can help predict how specific mutations might affect the transport mechanism .

How is ZntB expression regulated in Photorhabdus luminescens?

The regulation of ZntB expression in P. luminescens involves sophisticated mechanisms responding to environmental zinc concentrations and physiological demands:

  • Zinc-responsive transcription factors: Similar to other zinc transport systems, ZntB is likely regulated by zinc-responsive transcription factors analogous to Zur (zinc uptake regulator) and ZntR (zinc export regulator) found in related bacteria.

  • Promoter elements: The promoter region of the zntB gene likely contains zinc-responsive elements (ZREs) that mediate transcriptional control in response to changing zinc concentrations.

  • Environmental triggers: Expression studies in related systems suggest that ZntB expression increases under high zinc conditions to facilitate export of excess zinc, protecting the cell from zinc toxicity .

  • Integration with other metal homeostasis systems: Regulation of ZntB is likely coordinated with other zinc transporters and metallochaperones to maintain appropriate intracellular zinc levels.

For experimental investigation of ZntB regulation, researchers should consider transcriptional reporter fusions (like those used for mdtABC studies) where the ZntB promoter is fused to reporter genes like GFP . Such approaches can reveal the environmental and physiological conditions that influence ZntB expression.

How does ZntB function differ across bacterial species and what implications does this have for experimental design?

ZntB homologs across different bacterial species show notable functional variations that researchers must consider when designing experiments:

When studying P. luminescens ZntB specifically, researchers should note that this organism's unique lifecycle as an insect pathogen and nematode symbiont may impose specialized requirements on zinc homeostasis compared to model organisms like E. coli . The expression of transporter genes in P. luminescens has been shown to respond to host-specific environments, similar to what has been observed with the mdtABC system in insect hosts .

What methods are effective for studying ZntB function in the context of P. luminescens pathogenicity?

To investigate ZntB's role in P. luminescens pathogenicity, researchers should employ these methodological approaches:

  • Gene knockout and complementation: CRISPR-Cas9 or homologous recombination techniques to generate ΔzntB mutants, followed by phenotypic characterization and complementation with wild-type or modified zntB genes.

  • In vivo expression profiling: Similar to studies performed with the mdtABC operon, researchers can use transcriptional fusions between the zntB promoter and reporter genes (e.g., GFP) to monitor expression during insect infection, revealing spatiotemporal patterns of expression .

  • Host-specific zinc concentration manipulation: Investigating how modulation of zinc availability in the insect host affects P. luminescens survival, virulence, and ZntB expression.

  • Competitive infection assays: Co-infection of insect hosts with wild-type and ΔzntB mutant strains to determine the contribution of ZntB to fitness during infection.

  • Tissue localization studies: Immunohistochemistry or fluorescent protein fusions to track ZntB localization during different stages of insect infection.

These approaches can reveal whether ZntB affects critical virulence properties such as toxin production, survival within the insect host, or interaction with the nematode symbiont. Research on other P. luminescens transport systems has demonstrated tissue-specific expression patterns during infection that could also apply to ZntB .

How can researchers investigate the interaction between ZntB and other components of zinc homeostasis networks?

Investigating ZntB within the broader zinc homeostasis network requires integrative approaches:

  • Genetic interaction studies: Creating double or triple mutants of ZntB with other zinc transporters or regulators to identify synthetic phenotypes that reveal functional relationships.

  • Protein-protein interaction analysis: Techniques like bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling to identify proteins that physically interact with ZntB.

  • Systems biology approaches: Transcriptomics and proteomics to identify genes co-regulated with ZntB under various conditions, revealing functional networks.

  • Metabolic flux analysis: Tracking zinc movement through cellular compartments using zinc isotopes in wild-type versus ZntB mutant backgrounds.

  • Mathematical modeling: Developing computational models of zinc homeostasis that incorporate known kinetic parameters of ZntB and other transporters to predict system behavior under various conditions.

The interpretation of these experiments should consider that P. luminescens undergoes significant physiological changes during its lifecycle, transitioning between insect pathogenesis and nematode symbiosis . These different environments likely impose varying demands on zinc homeostasis systems, potentially resulting in condition-specific interaction networks.

What are the major technical challenges in studying ZntB function and how can they be addressed?

Researchers investigating ZntB face several significant technical challenges:

  • Membrane protein solubility: As a membrane protein, ZntB is inherently difficult to solubilize while maintaining native structure and function. Solution: Systematic screening of detergents and nanodiscs or amphipols for stabilization, and consideration of fusion partner approaches to improve solubility.

  • Transport assay sensitivity: Zinc transport can be difficult to measure accurately due to background binding and contamination. Solution: Rigorous metal-free experimental conditions, multiple complementary assay types, and appropriate controls with transport-inactive mutants.

  • Physiological relevance of in vitro systems: Reconstituted systems may not perfectly recapitulate the native membrane environment. Solution: Compare results across multiple experimental systems (proteoliposomes, whole cells, inverted membrane vesicles) and validate with in vivo functional studies.

  • Distinguishing direct from indirect effects in vivo: Phenotypes of zntB mutants may result from complex downstream effects rather than direct loss of transport function. Solution: Combine genetic approaches with direct biochemical measurements and use point mutants that specifically affect transport function without disrupting protein stability.

  • Zinc bioavailability in experimental systems: The speciation and bioavailability of zinc can vary dramatically between experimental conditions. Solution: Careful control of zinc speciation through appropriate buffering systems and consideration of physiologically relevant zinc concentrations.

Addressing these challenges requires a multi-faceted experimental approach and careful interpretation of results across different experimental systems.

How should researchers address data inconsistencies when studying ZntB from different experimental approaches?

When faced with conflicting data about ZntB function from different experimental approaches, researchers should follow this systematic troubleshooting framework:

  • Evaluate experimental conditions: Assess whether differences in pH, temperature, ionic strength, zinc concentration, or membrane composition might explain disparate results.

  • Consider protein state: Verify that the protein is correctly folded and oligomerized in each experimental system, as pentamer formation is critical for function.

  • Examine time scales: Different methods measure processes on different time scales, from milliseconds (electrophysiology) to minutes (radioisotope uptake), potentially revealing different aspects of the transport cycle.

  • Verify specificity: Confirm that the observed effects are specific to ZntB using appropriate controls such as transport-deficient mutants.

  • Reconcile through modeling: Develop mechanistic models that can potentially explain seemingly contradictory results by incorporating multiple steps in the transport cycle.

  • Cross-validate with orthogonal methods: When possible, use completely independent techniques to verify key findings.

A common example of apparent data inconsistency involves differences between binding affinities measured by ITC and functional transport parameters from uptake assays . Such discrepancies often reflect real biological complexity rather than experimental error, as binding does not necessarily couple directly to transport in all conditions.

What are promising approaches for developing ZntB-targeted antimicrobial strategies?

The essential role of zinc homeostasis in bacterial physiology suggests several promising research directions for ZntB-targeted antimicrobials:

  • Structure-based inhibitor design: Using the cryo-EM structure of ZntB to design small molecules that block the transport pathway or interfere with conformational changes required for transport .

  • Allosteric modulators: Identifying binding sites outside the transport pathway that can lock ZntB in inactive conformations.

  • Zinc ionophores: Developing compounds that bypass ZntB-mediated zinc export, causing toxic zinc accumulation in bacterial cells.

  • Repurposing approved metal-binding drugs: Screening existing drugs with metal-binding properties for activity against ZntB function.

  • Host-directed therapies: Manipulating host zinc levels during infection to create conditions where ZntB dysfunction compromises bacterial survival.

For P. luminescens specifically, researchers should consider the unique lifecycle of this bacterium and its interaction with both insect hosts and nematode symbionts . Targeting ZntB function might disrupt the precise zinc homeostasis required for these complex interactions, potentially interfering with the bacterium's pathogenicity or symbiotic capabilities.

What methodological advances would accelerate ZntB research in the coming years?

Several technological and methodological advances would significantly advance ZntB research:

  • Advanced imaging techniques: Further development of single-particle cryo-EM methods to capture ZntB in different conformational states during the transport cycle.

  • Improved membrane mimetics: Development of better membrane mimetic systems that more accurately recreate the native bacterial membrane environment for functional studies.

  • Real-time zinc sensors: Development of genetically encoded zinc sensors with improved sensitivity and specificity for monitoring zinc flux in live bacteria during infection.

  • High-throughput functional assays: Adaptation of zinc transport assays to high-throughput formats for comprehensive mutational analysis or inhibitor screening.

  • Integrative structural biology: Combining multiple structural approaches (cryo-EM, X-ray crystallography, NMR, molecular dynamics) to develop comprehensive models of the transport mechanism.

  • Advanced genetic tools for P. luminescens: Refinement of genetic manipulation techniques specifically optimized for P. luminescens to facilitate in vivo studies of ZntB function.

Researchers applying these advanced methods could rapidly accelerate our understanding of ZntB function and potentially develop novel strategies to target bacterial pathogens that rely on precise zinc homeostasis for virulence and survival.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.