Recombinant Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Chaetosphaeridium globosum (Charophycean green alga) (Herposteiron globosum)
Target Names
ycf4
Target Protein Sequence
MNIKSEFFRVDFIIGARRLSNYFWATVVFLGSLGFFIVGVSSYLQKNIVFFLSASDILFT PQGIVMCFYGIAGLFLSFYLWFTIFLDIGSGYNEFDKKKGIISIFRWGYPGQNRRIKLSF PIKDVQAIKLEVKEVLPARRMIYIKIKGQQDIPLNRIAENITLREMEDKAADLARFLKVS IEGL
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Ycf4 protein and what is its primary function?

Ycf4 (hypothetical chloroplast open reading frame 4) is a thylakoid membrane protein that serves as an essential assembly factor for Photosystem I (PSI) in photosynthetic organisms. Its primary function involves mediating the interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex . The protein acts as a scaffold, facilitating the formation of pigment-containing subcomplexes that ultimately develop into functional PSI complexes . In Chlamydomonas reinhardtii, Ycf4 has been conclusively demonstrated to be essential for the accumulation of PSI, as Ycf4-deficient mutants are unable to photosynthesize properly . While some conflicting results have emerged from studies in cyanobacteria and partial knockouts in tobacco, comprehensive research with complete gene deletion confirms Ycf4's critical role in photosynthesis .

Where is Ycf4 located within the cell and how is it organized?

Ycf4 is primarily located in the thylakoid membranes of chloroplasts in photosynthetic eukaryotes . Within these membranes, Ycf4 forms part of a large multimeric complex exceeding 1500 kD in size . This complex contains not only Ycf4 but also several other proteins, including the opsin-related COP2 protein and various PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) . Electron microscopy studies have revealed that the largest structures in purified Ycf4 preparations measure approximately 285 × 185 Å, suggesting the complex may exist in several large oligomeric states . The intimate association between Ycf4 and COP2 has been demonstrated through copurification experiments involving sucrose gradient ultracentrifugation and ion exchange column chromatography, where almost all Ycf4 and COP2 in wild-type cells copurified together .

Is Ycf4 conserved across different photosynthetic organisms?

Ycf4 is highly conserved across diverse photosynthetic organisms, though its essentiality may vary. In Chlamydomonas reinhardtii, Ycf4 is absolutely essential for PSI accumulation and photoautotrophic growth . In contrast, cyanobacterial homologs (such as Orf184 in Synechocystis) appear less critical, as mutants can maintain photoautotrophic growth despite showing altered pigment content, particularly in the phycocyanin to chlorophyll ratio . Interestingly, evolutionary rate analysis indicates that Ycf4 exhibits higher rates of evolution in high-altitude plant species compared to low-altitude relatives, suggesting potential adaptation to extreme environmental conditions . This variable evolutionary pressure on Ycf4 across different ecological niches indicates its potential role in environmental adaptation of photosynthetic machinery.

What is the molecular composition of the Ycf4 complex?

The Ycf4 complex is a large molecular assembly exceeding 1500 kD that contains multiple protein components . Mass spectrometry (liquid chromatography-tandem mass spectrometry) and immunoblotting analyses have identified several key components of this complex. In addition to Ycf4 itself, the complex contains the opsin-related protein COP2 and several PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Pulse-chase protein labeling experiments have revealed that the PSI polypeptides associated with the Ycf4 complex are newly synthesized and partially assembled as pigment-containing subcomplexes . This finding suggests that the Ycf4 complex functions as an intermediate assembly platform where newly synthesized PSI components begin the process of integration into functional photosystems.

How does the structure of Ycf4 relate to its function?

The Ycf4 protein contains structurally and functionally distinct domains that contribute differently to its role in PSI assembly. In-silico protein-protein interaction studies comparing the N-terminal (93 aa) and C-terminal (91 aa) portions of the 184-amino acid Ycf4 protein have revealed that the C-terminus plays a particularly critical role in interacting with other chloroplast proteins . Molecular docking studies demonstrate that the C-terminus of Ycf4 forms more numerous and stronger hydrogen bonds with photosynthetic proteins compared to the N-terminus. For instance, while the N-terminus of Ycf4 forms five hydrogen bonds with PsaB, the C-terminus forms twelve hydrogen bonds with PsaH . Similarly, the C-terminus forms twenty-eight hydrogen bonds with AtpB (ATP synthase beta chain), compared to only eight bonds formed by the N-terminus . These findings explain why partial knockouts affecting only the N-terminal portion may retain some functionality, while complete deletions result in severe photosynthetic deficiencies.

ProteinHydrogen Bonds with N-terminus of Ycf4Hydrogen Bonds with C-terminus of Ycf4
PsaB5Not specified
PsaHNot specified12
PsbE6Not specified
PsbCNot specified13
Rps2147
Rps161811
Rrn16186
AtpB828
RpoB925

What is the relationship between Ycf4 and COP2?

The opsin-related protein COP2 has been identified as a key interaction partner of Ycf4 in the PSI assembly complex . Biochemical analyses have demonstrated an intimate and exclusive association between Ycf4 and COP2, as almost all of these proteins copurify together from wild-type cells using sucrose gradient ultracentrifugation followed by ion exchange column chromatography . Despite this tight association, RNA interference experiments reducing COP2 levels to approximately 10% of wild-type levels revealed that while this reduction increased the salt sensitivity of the Ycf4 complex, it did not significantly affect PSI accumulation . This finding suggests that while COP2 contributes to the stability of the Ycf4 complex under varying ionic conditions, it is not absolutely essential for the primary function of PSI assembly. The precise molecular mechanism by which COP2 interacts with Ycf4 and influences complex stability remains an active area of research.

How can researchers purify the Ycf4 complex for experimental studies?

Purification of the Ycf4 complex can be achieved through a well-established tandem affinity purification (TAP) approach that has proven effective in isolating the intact complex while preserving its structural integrity and associated components . This method involves generating transgenic lines expressing TAP-tagged Ycf4 fusion proteins. The TAP-tag consists of calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site . The purification process follows these methodological steps: First, thylakoid membranes are isolated and solubilized with a detergent such as n-dodecyl-β-D-maltoside (DDM). Next, the solubilized proteins are subjected to a two-step affinity chromatography process - initial binding to IgG agarose (utilizing the Protein A domain), followed by protease cleavage and subsequent purification via calmodulin affinity resin . This approach has demonstrated an efficient recovery of approximately 90% of Ycf4 from thylakoid extracts in the initial IgG agarose binding step . Researchers should verify that the TAP-tag fusion does not interfere with Ycf4 function through complementation assays and photosynthetic activity measurements.

What techniques are most effective for studying Ycf4 protein interactions?

Multiple complementary techniques have proven valuable for characterizing Ycf4 protein interactions and complex composition. Mass spectrometry (specifically liquid chromatography-tandem mass spectrometry) has been successfully employed to identify proteins associated with purified Ycf4 complexes . Immunoblotting with antibodies specific to potential interaction partners provides further verification of complex components . Sucrose gradient ultracentrifugation coupled with ion exchange chromatography offers a means to examine the co-purification behavior of Ycf4 and potential interacting proteins such as COP2 . For structural characterization of the complex, transmission electron microscopy and single particle analysis have revealed the dimensions and morphology of the Ycf4 complex . Additionally, pulse-chase protein labeling experiments have proven valuable in determining whether associated proteins are newly synthesized or represent stable interactions . For in-silico prediction and modeling of interactions, protein docking studies can identify potential binding interfaces and hydrogen bonding patterns between Ycf4 and other chloroplast proteins . These computational approaches are particularly useful for comparing interaction potentials of different domains within Ycf4.

What molecular mechanisms underlie Ycf4's role in Photosystem I assembly?

The molecular mechanisms through which Ycf4 facilitates PSI assembly involve its function as a scaffold that mediates specific interactions between newly synthesized PSI components . Pulse-chase protein labeling experiments have revealed that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as pigment-containing subcomplexes . This suggests that Ycf4 acts at an early stage of PSI biogenesis, potentially coordinating the initial interactions between core PSI subunits and facilitating their proper folding and cofactor incorporation. The large size of the Ycf4 complex (>1500 kD) provides an extensive interaction surface that can accommodate multiple PSI components simultaneously . Importantly, Ycf4 appears to function specifically in assembly rather than in the transcription or translation of PSI components, as transcriptome analysis of Ycf4-deficient plants showed unchanged expression levels of genes encoding PSI and PSII components . The reduced accumulation of PSI in Ycf4 mutants thus likely results from impaired assembly or enhanced degradation of improperly assembled complexes rather than reduced synthesis of individual components.

How do contradicting findings about Ycf4 essentiality reconcile?

The apparent contradictions in literature regarding Ycf4 essentiality can be reconciled through careful analysis of experimental approaches and organismal differences. In Chlamydomonas reinhardtii, complete knockout of Ycf4 renders cells incapable of photoautotrophic growth, clearly demonstrating its essential nature in this organism . Similarly, complete removal of the Ycf4 gene from tobacco chloroplasts resulted in plants unable to survive photoautotrophically, with severe structural anomalies in chloroplasts . In contrast, cyanobacterial mutants deficient in the Ycf4 homolog (Orf184) maintained photoautotrophic growth despite altered pigment content . These differences likely reflect evolutionary divergence in photosynthetic machinery and potentially the presence of compensatory mechanisms in some organisms. Additionally, studies concluding non-essentiality of Ycf4 in tobacco were based on incomplete knockouts that retained the C-terminal portion of the protein . In-silico protein interaction studies have since revealed that this C-terminal region forms stronger interactions with photosynthetic proteins than the N-terminus . This explains why partial knockouts might retain sufficient functionality for photosynthesis, while complete gene deletions reveal the essential nature of the protein.

What evolutionary patterns are observed in Ycf4 across different photosynthetic lineages?

Evolutionary analysis of Ycf4 across different photosynthetic lineages reveals interesting patterns related to environmental adaptation. Studies of high-altitude plant species have shown that genes in the ycf family, including ycf4, frequently exhibit higher evolutionary rates compared to their low-altitude counterparts . This accelerated evolution suggests potential adaptation to extreme environmental conditions, such as high light intensity, temperature fluctuations, or oxidative stress prevalent at high altitudes. The evolutionary pressure on Ycf4 likely reflects its critical role in maintaining efficient photosynthesis under varying environmental conditions. Additionally, the differential essentiality of Ycf4 across lineages (essential in Chlamydomonas and higher plants, less critical in cyanobacteria) indicates potential functional divergence throughout evolutionary history . These patterns suggest that while the core function of Ycf4 in PSI assembly is conserved, the protein may have acquired additional roles or regulatory mechanisms in different photosynthetic lineages, potentially related to environmental adaptation and optimization of photosynthetic efficiency in various ecological niches.

How should researchers interpret transcriptome data from Ycf4-deficient organisms?

Interpreting transcriptome data from Ycf4-deficient organisms requires careful consideration of both direct and indirect effects of Ycf4 loss. Research in tobacco Δycf4 plants revealed that while expression of genes encoding PSI, PSII, and ribosomal proteins remained largely unchanged, transcriptome levels of rbcL (encoding the large subunit of Rubisco), LHC (light-harvesting complex), and ATP synthase components (atpB and atpL) decreased significantly . This differential impact suggests that Ycf4 may have functions beyond direct PSI assembly, potentially influencing regulatory networks that coordinate expression of various photosynthetic components. When analyzing such transcriptome data, researchers should first distinguish between primary effects (directly linked to Ycf4 function) and secondary effects (resulting from physiological adaptation to impaired photosynthesis). Pathway enrichment analysis can help identify coordinated changes in gene sets related to specific cellular processes. Time-course studies following Ycf4 depletion may help separate immediate from adaptive responses. Additionally, complementation experiments restoring Ycf4 function can verify which transcriptional changes are reversible and thus likely direct consequences of Ycf4 deficiency rather than developmental adaptations to long-term photosynthetic impairment.

What approaches are recommended for analyzing protein-protein interactions involving Ycf4?

Analysis of protein-protein interactions involving Ycf4 requires a multi-faceted approach combining experimental and computational methods. For experimental data, researchers should consider quantitative proteomics approaches such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling to compare the abundance of proteins co-purifying with wild-type versus mutated Ycf4 variants . Crosslinking mass spectrometry can identify specific interaction interfaces between Ycf4 and its partners. For computational analysis, molecular docking studies have proven valuable in predicting interaction potentials between different domains of Ycf4 and various chloroplast proteins . When analyzing such docking data, researchers should consider not only the number of hydrogen bonds formed but also their stability, length, and the conservation of the participating residues. Network analysis integrating multiple protein interaction datasets can help visualize the centrality of Ycf4 in photosynthetic protein networks and identify key interaction clusters. To validate predicted interactions, targeted mutagenesis of specific residues followed by co-immunoprecipitation or yeast two-hybrid assays can confirm the functional importance of putative interaction sites.

Analysis ApproachApplication to Ycf4Key Considerations
Co-purificationIdentification of stable Ycf4 complex componentsDetergent choice affects membrane protein solubilization
Mass SpectrometryIdentification of protein components in purified complexesDistinguish specific from non-specific interactions
Electron MicroscopyStructural characterization of Ycf4 complexesSample heterogeneity may complicate single particle analysis
Molecular DockingPrediction of interaction interfacesValidate computationally predicted interactions experimentally
Domain Deletion AnalysisFunctional importance of N vs C-terminusComplete vs partial deletions may yield different results
TranscriptomicsGlobal effects of Ycf4 deficiencyDistinguish direct from indirect regulatory effects

What are the remaining knowledge gaps in understanding Ycf4 function?

Despite significant advances in understanding Ycf4, several knowledge gaps remain that warrant further investigation. The precise molecular mechanism by which Ycf4 coordinates the assembly of PSI components remains unclear, particularly regarding the temporal sequence of interactions and the role of post-translational modifications in regulating Ycf4 function . The structural basis for the recognition of newly synthesized PSI polypeptides by Ycf4 has not been fully elucidated. Additionally, while the C-terminus of Ycf4 has been identified as crucial for protein interactions, the specific residues that mediate these interactions and how they might be regulated under different environmental conditions remain to be determined . The functional relationship between Ycf4 and COP2 requires further clarification, especially regarding how COP2 contributes to Ycf4 complex stability without being essential for PSI assembly . The potential additional functions of Ycf4 beyond PSI assembly, suggested by its impact on the expression of genes like rbcL and ATP synthase components, merit exploration . Finally, the evolutionary adaptation of Ycf4 in response to environmental pressures, particularly in high-altitude species, offers an intriguing avenue for investigating the molecular basis of photosynthetic adaptation to extreme conditions .

What novel techniques might advance Ycf4 research?

Emerging techniques in structural biology, molecular genetics, and systems biology offer promising approaches for addressing remaining questions about Ycf4 function. Cryo-electron microscopy could provide higher-resolution structures of the Ycf4 complex, potentially capturing different assembly intermediates with associated PSI components . Single-molecule fluorescence techniques such as FRET (Förster Resonance Energy Transfer) could track the dynamic interactions between Ycf4 and its partners in real-time. CRISPR-Cas9 genome editing, adapted for chloroplast transformation, might enable more precise manipulation of Ycf4, including domain-specific mutations and tagged variants for in vivo imaging . Optogenetic approaches could allow temporal control of Ycf4 function, helping distinguish direct from indirect effects of Ycf4 deficiency. Integrative multi-omics analyses combining proteomics, transcriptomics, and metabolomics could provide a comprehensive view of how Ycf4 deficiency impacts cellular physiology across different timescales. Finally, comparative genomics approaches examining Ycf4 sequence and function across species adapted to different environmental conditions could yield insights into the evolutionary mechanisms underlying photosynthetic adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.