Recombinant Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
psaF; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-187
Protein Length
Full Length of Mature Protein
Species
Cyanidium caldarium (Red alga)
Target Names
psaF
Target Protein Sequence
STLTPCENSAQFQARLNNNIKKLENKLTYYKQNSQEYTSIKQQIEKTKIRFDKYAKSSLL CGEDGLPHLITDGDWQHSGEFFIPSVLFIYIAGWIGWAGKGYLQYSKTLTKPNENEIIID LPRALKYMFSGFAWPILALKEFKNGSLLASNDEITTSPR
Uniprot No.

Target Background

Function

Recombinant Photosystem I reaction center subunit III (psaF) likely participates in the efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein facilitates the specific binding of plastocyanin to PSI.

Protein Families
PsaF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Photosystem I reaction center subunit III (psaF) and its primary function?

Photosystem I reaction center subunit III (psaF) is an essential protein component of the Photosystem I (PSI) complex in photosynthetic organisms. It serves as a critical mediator of electron transfer processes during photosynthesis, specifically facilitating the interaction between PSI and its mobile electron donors – plastocyanin (pc) and cytochrome c6 (cyt c6). The protein contains an N-terminal domain that forms a precise recognition site for these electron donors, featuring a conserved α-helical structure with positively charged lysine residues that interact with the negatively charged patches on the electron donor proteins . While PSI complexes remain structurally stable without psaF in some organisms (as demonstrated in the PsaF-deficient mutant 3bF of Chlamydomonas reinhardtii), the absence of psaF significantly impairs the efficiency of electron transfer from the mobile donors to PSI .

How can researchers express recombinant psaF for experimental studies?

Recombinant psaF can be expressed using several methodological approaches depending on research objectives. The most common approach involves heterologous expression in E. coli systems. For this method, researchers typically clone the psaF gene into an expression vector containing an appropriate promoter and a fusion tag (commonly a His-tag) to facilitate purification. The recombinant protein is then expressed as a fusion protein with an N-terminal His-tag that allows for simplified purification using affinity chromatography . For more physiologically relevant studies, researchers can use the nuclear transformation approach exemplified in Chlamydomonas reinhardtii studies. This involves transforming a PsaF-deficient mutant (like 3bF) with plasmids containing modified psaF genes, often using cotransformation with selection markers like the cry1 gene (conferring resistance to cryptopleurine and emetine) or the ble gene (conferring resistance to phleomycin and zeocin) . For successful expression, researchers should verify transformation by PCR and confirm protein expression through immunoblot analysis, as expression frequencies may vary among transformants .

What analytical techniques are most effective for verifying psaF protein quality and activity?

Multiple analytical techniques can be employed to verify both the structural integrity and functional activity of recombinant psaF. For primary structure confirmation, mass spectrometry provides precise molecular weight determination and can verify the presence of any post-translational modifications. Circular dichroism spectroscopy helps assess secondary structure features, particularly the α-helical content critical for psaF function. Functional verification typically employs flash absorption spectroscopy to measure electron transfer kinetics from donor proteins (plastocyanin or cytochrome c6) to PSI complexes containing the recombinant psaF . Additionally, crosslinking studies using chemical crosslinkers followed by SDS-PAGE and immunoblotting with PsaF antibodies can effectively evaluate the protein's ability to interact with its electron donor partners . When working with recombinant psaF expressed in heterologous systems, researchers should perform reconstitution assays with isolated PSI complexes to confirm that the recombinant protein can assemble properly into the photosystem and restore electron transfer functionality.

What model organisms are most suitable for studying psaF function?

Chlamydomonas reinhardtii has emerged as a particularly valuable model organism for psaF studies due to several experimental advantages. This green alga offers a powerful genetic system where nuclear transformation and site-directed mutagenesis of psaF can be readily performed, as demonstrated in studies with the PsaF-deficient mutant 3bF . The ability to conduct reverse genetics with nuclear genes involved in photosynthesis makes C. reinhardtii an ideal system for structure-function analyses of psaF . Higher plants such as Arabidopsis thaliana and spinach also serve as important models, particularly for comparative studies examining evolutionary conservation of psaF function across species. Cyanobacteria, especially Synechocystis sp. PCC 6803, provide simpler model systems for studying psaF in prokaryotic photosynthetic organisms. When selecting a model organism, researchers should consider their specific experimental objectives, available genetic tools, and the physiological context most relevant to their research questions.

How do specific mutations in the N-terminal domain affect electron transfer kinetics?

Mutations in the N-terminal domain of psaF have revealed a precise molecular recognition mechanism that governs electron transfer kinetics. Specific lysine residues in this domain exhibit differential impacts on the binding and electron transfer from plastocyanin (pc) and cytochrome c6 (cyt c6) to Photosystem I (PSI). Research using site-directed mutagenesis in Chlamydomonas reinhardtii has demonstrated that the K23Q mutation produces the most dramatic effects, drastically reducing crosslinking efficiency with pc and significantly diminishing electron transfer rates . Quantitative kinetic analysis shows that the K23Q mutation decreases the second-order rate constants for binding of pc and cyt c6 by factors of 13 and 7, respectively . The K16Q and K30Q mutations exhibit smaller but still significant effects on binding rates, while the K12P mutation shows negligible impact on binding compared to wild-type . Importantly, none of these mutations affect the half-life of the microsecond electron transfer occurring within the established donor-PSI complex, indicating that these residues primarily influence the formation of the electron transfer complex rather than the electron transfer process itself . This differential impact of individual lysine residues reveals a highly specific recognition site within the N-terminal domain of psaF that is essential for optimal interactions with both pc and cyt c6.

What techniques enable precise measurement of psaF-mediated electron transfer?

Advanced biophysical techniques provide crucial insights into the electron transfer processes mediated by psaF. Flash absorption spectroscopy remains the gold standard for quantifying electron transfer kinetics, allowing researchers to measure both the binding rate constants and the electron transfer rates within the established donor-PSI complex . This technique can distinguish between these two processes, revealing that mutations in psaF typically affect binding rates rather than the actual electron transfer step. For structural studies of the psaF-donor protein complex, a combination of chemical crosslinking followed by mass spectrometry can identify specific interaction sites. X-ray crystallography and cryo-electron microscopy of the entire PSI complex with bound electron donors provide atomic-level insights into the structural basis of these interactions. Time-resolved spectroscopic techniques, including femtosecond transient absorption spectroscopy, enable researchers to resolve the ultrafast electron transfer events occurring after complex formation. Additionally, surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) offer complementary approaches for measuring binding affinities and thermodynamic parameters of psaF interactions with its electron donor partners under varying experimental conditions.

How can researchers optimize crosslinking methodologies for studying psaF interactions?

Optimizing crosslinking methodologies for psaF interaction studies requires careful consideration of multiple experimental parameters. The choice of crosslinker is critical – EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide) is particularly effective for studying psaF interactions as it links carboxyl groups (abundant in the acidic patch of plastocyanin) with amino groups (found in the lysine-rich N-terminal domain of psaF) . Researchers should optimize reactant concentrations, with typical molar ratios of PSI:electron donor:crosslinker around 1:5:1000, though these should be empirically determined for each experimental system. The crosslinking reaction conditions, including pH (typically 6.0-7.5), buffer composition (phosphate or MES buffers are common), temperature (usually 25°C), and reaction time (10-30 minutes) all significantly impact crosslinking efficiency. Following crosslinking, products should be analyzed using SDS-PAGE followed by immunoblotting with anti-PsaF antibodies to visualize the crosslinked complexes . For more detailed analysis, the crosslinked products can be digested with proteases and analyzed by mass spectrometry to identify the specific residues involved in crosslinking. Additionally, researchers should consider performing control reactions using mutated variants of both psaF and electron donors to validate the specificity of observed interactions and confirm the involvement of particular residues.

How does the amphipathic α-helical structure of psaF contribute to its function?

The N-terminal domain of psaF contains a distinctive amphipathic α-helical structure that plays a crucial role in its functionality. This α-helix features positively charged lysine residues (particularly K12, K16, K23, and K30) positioned on one face of the helix, creating a positively charged interaction surface . This structural arrangement is evolutionarily conserved across photosynthetic organisms, including both Chlamydomonas reinhardtii and higher plants such as spinach, suggesting its fundamental importance to photosynthetic electron transfer . The amphipathic nature of this α-helix allows it to form precise electrostatic interactions with the negatively charged patches on electron donor proteins like plastocyanin (specifically residues 42-44) and cytochrome c6 . The functional significance of this structural feature is evidenced by mutation studies where altering individual lysine residues, particularly K23, dramatically impairs binding and electron transfer efficiency . The positively charged face of the α-helix likely serves as an initial recognition site that guides the orientation of the electron donors relative to PSI, facilitating the formation of a productive electron transfer complex. This structure-function relationship exemplifies how specific secondary structural elements can create precise recognition interfaces for protein-protein interactions in photosynthetic electron transport chains.

What experimental approaches best elucidate the binding interface between psaF and electron donors?

Multiple complementary experimental approaches can be employed to elucidate the precise binding interface between psaF and its electron donors. Site-directed mutagenesis combined with functional assays remains a powerful strategy, as demonstrated in studies where mutations of specific lysine residues in psaF (particularly K23Q) produced dramatic effects on binding and electron transfer . Chemical crosslinking followed by mass spectrometry provides direct evidence of physical interactions, identifying specific residues at the binding interface. When performing crosslinking experiments, researchers should use reagents that target the relevant functional groups – for instance, EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide) for connecting carboxyl groups on plastocyanin with amino groups on psaF . Computational approaches, including molecular docking and molecular dynamics simulations, can generate models of the complex that can then be validated experimentally. NMR spectroscopy offers another powerful approach for mapping binding interfaces through chemical shift perturbation experiments, where changes in NMR signals upon complex formation identify residues at the interface. X-ray crystallography and cryo-electron microscopy of the entire PSI complex with bound electron donors provide the most comprehensive structural information, though obtaining such structures presents significant technical challenges. By integrating data from these complementary approaches, researchers can develop a comprehensive understanding of the precise molecular interactions at the psaF-donor protein interface.

What evolutionary conservation patterns exist in psaF across photosynthetic organisms?

The evolutionary conservation patterns in psaF across diverse photosynthetic organisms reveal important insights about its functional significance. The N-terminal domain containing the amphipathic α-helical structure with positively charged lysine residues shows remarkable conservation from green algae to higher plants, indicating its fundamental importance to photosynthetic electron transfer . Specifically, the lysine residues K12, K16, K23, and K30 in the N-terminal domain that form the positively charged face of the putative amphipathic α-helix are highly conserved across species . This conservation extends to functional aspects as well – despite structural differences between plastocyanin and cytochrome c6, the same residues in psaF appear to mediate binding to both alternative electron donors, suggesting an evolutionarily conserved binding mechanism . While the core functional domains show strong conservation, some species-specific variations exist, particularly in regions not directly involved in electron donor interactions. Comparative genomic analysis reveals that psaF is encoded by the nuclear genome in eukaryotic photosynthetic organisms, representing an evolutionary transfer from the ancestral plastid genome. Understanding these conservation patterns provides valuable insights for designing experiments, interpreting results, and developing hypotheses about the fundamental mechanisms of photosynthetic electron transfer across different taxonomic groups.

How should researchers interpret conflicting data from psaF mutation studies?

When faced with conflicting data from psaF mutation studies, researchers should implement a systematic analytical framework to reconcile disparate findings. First, critically examine methodological differences between studies, including the specific mutation techniques, expression systems, and assay conditions that might contribute to divergent results. For instance, the precise impact of mutations can vary depending on whether recombinant proteins are expressed in E. coli or through nuclear transformation in Chlamydomonas reinhardtii . Second, consider the specific parameters being measured – conflicting results may arise when different aspects of psaF function are assessed, such as binding affinity versus electron transfer rates . Third, evaluate the physiological context of each study, as the functional impact of psaF mutations may differ between in vitro reconstituted systems and in vivo cellular environments. Construct a comparison table presenting the conflicting data alongside methodological details to identify patterns that might explain discrepancies. When analyzing crosslinking or electron transfer data, consider that different amino acid substitutions at the same position might have varied effects based on the specific physicochemical properties of the introduced residue . Finally, design validation experiments that directly address the conflicting findings, potentially combining approaches from different studies to determine which results are reproducible under controlled conditions.

How can researchers effectively visualize complex psaF interaction data?

Effective visualization of complex psaF interaction data requires thoughtful selection of graphical representations tailored to the specific data types. For kinetic data from flash absorption spectroscopy, semi-logarithmic plots displaying signal amplitude versus time effectively highlight multi-phase decay processes, while bar graphs comparing rate constants across multiple mutations provide clear visualization of relative effects . When representing crosslinking efficiency data, researchers should consider using heatmaps that display the relative intensities of crosslinked products across different experimental conditions, with color intensity representing crosslinking efficiency . For structural data, three-dimensional molecular visualizations highlighting the key interaction residues on both psaF and electron donor proteins help communicate spatial relationships that are difficult to convey in tables or graphs. Network diagrams can effectively represent multiple interaction partners and their relative binding affinities, particularly useful when comparing wild-type and mutant proteins. When presenting data from multiple experimental approaches, consider using multi-panel figures that juxtapose complementary data types (e.g., structural models alongside functional measurements) to facilitate integrated interpretation. All visualizations should include appropriate statistical indicators (error bars, significance markers) and be accompanied by detailed legends explaining data transformation or normalization procedures. Color choices should accommodate color vision deficiencies, and axis scaling should be carefully considered to avoid distorting data relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.