Recombinant Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Emiliania huxleyi (Pontosphaera huxleyi)
Target Names
psaL
Target Protein Sequence
MSEFVKPYNNDPFVGNLSTPVTTSTATKLYLGNLPIYRKGLSPLLRGLEIGMAHGYFLIG PFYILGPLRNSPNALLVGLFSAFGLILILTLGLTIYGLASFQGTEGGENLESAKGWRNFT SGFSIGAFGGASVAYVLLDNISFFA
Uniprot No.

Target Background

Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural position of PsaL within the Photosystem I complex?

PsaL is located on the side of Photosystem I (PSI) opposite to the LHCA belt, forming part of a nose-shaped structure together with PsaH and PsaI subunits. Crystallographic data from pea (Pisum sativum) PSI reveals that PsaL physically interacts with the PsaB reaction center subunit and small peripheral subunits PsaH and PsaI. This positioning is critical for its function in stabilizing the PSI complex, particularly during environmental stress conditions . In cyanobacteria, PsaL is involved in organizing PSI into trimeric or tetrameric structures, while in higher plants, it contributes to the binding site for mobile LHCII during state transitions .

How does PsaL differ across photosynthetic organisms?

PsaL shows significant structural and functional variations across different photosynthetic organisms:

Organism TypePsaL CharacteristicsPrimary FunctionKey Structural Features
CyanobacteriaHighly conserved in trimerization domainMediates PSI oligomerization (trimers/tetramers)Contains specific loop sequences that influence oligomerization
Higher PlantsLacks trimerization domainContributes to LHCII binding during state transitionsInteracts with PsaH (unique to plants)
Algae (e.g., Emiliania huxleyi)Intermediate characteristicsBeing investigatedContains unique amino acid sequences

In heterocyst-forming cyanobacteria, PsaL often contains a distinctive proline-rich motif (NPPxP followed by PNPP) in the loop sequence between the second and third transmembrane helices, which is associated with tetrameric PSI formation .

Which expression systems are most effective for recombinant PsaL production?

Multiple expression systems have been successfully employed for recombinant PsaL production, each with specific advantages:

E. coli: Most commonly used for basic research applications due to its simplicity and high yield. The XylS/Pm regulator/promoter system has proven particularly effective for controlled expression of proteins like PsaL . This system can be optimized through combinatorial mutagenesis to achieve desired expression profiles and can function across different bacterial species .

For more complex applications requiring post-translational modifications:

  • Yeast systems offer eukaryotic processing capabilities

  • Baculovirus expression systems provide high yield of properly folded protein

  • Mammalian cell expression is preferred when authentic folding and modifications are critical

The choice should be guided by research needs, with consideration for protein solubility, which can be challenging with membrane proteins like PsaL .

What purification strategies optimize yield and activity of recombinant PsaL?

Effective purification of recombinant PsaL requires specialized approaches due to its membrane-associated nature:

  • Buffer optimization: Tris-based buffers with 50% glycerol have proven effective for maintaining stability

  • Solubilization: Membrane proteins like PsaL typically require detergent solubilization; mild detergents that maintain protein-protein interactions are preferred

  • Storage conditions: Store at -20°C for short-term use or -80°C for extended storage; avoid repeated freeze-thaw cycles

  • Working conditions: Maintain aliquots at 4°C for up to one week during experiments

For antibody production applications, fusion protein strategies have been successfully employed, as demonstrated in the CATSPsaL design that incorporated fragments from different PsaL proteins to achieve high antigenicity while maintaining structural integrity .

How can recombinant PsaL be used to study PSI oligomerization states?

Recombinant PsaL has been instrumental in elucidating the mechanisms of PSI oligomerization through gene replacement experiments. To investigate this:

  • Generate knockout mutants lacking endogenous PsaL using homologous recombination or CRISPR/Cas9 systems

  • Complement with recombinant PsaL variants using standardized genome architecture approaches

  • Employ blue-native PAGE or size-exclusion chromatography to assess PSI oligomerization state changes

  • Verify PsaL incorporation using western blotting with specific antibodies

Key findings from such studies include:

  • Replacement of wild-type PsaL in Synechocystis sp. PCC 6803 with PsaL from TS-821 or Arabidopsis resulted in monomerization of normally trimeric PSI

  • The loop sequence between the second and third transmembrane helices, particularly a proline-rich motif, plays a critical role in determining oligomerization state

  • These findings provide a model for evolutionary transitions in PSI organization from cyanobacteria to higher plants

What methods are most effective for analyzing PsaL interactions with other PSI subunits?

Researching PsaL interactions with other PSI subunits requires sophisticated biophysical and biochemical approaches:

  • In vivo crosslinking followed by immunoprecipitation can capture transient or weak interactions

  • Förster resonance energy transfer (FRET) using fluorescently tagged PSI subunits enables visualization of protein-protein interactions in native membranes

  • Split-GFP complementation assays provide evidence for direct interactions when fused to potential partner proteins

  • Co-purification studies using affinity-tagged PsaL variants can identify interaction partners

Recent studies have revealed that:

  • PsaL interacts with PsaI, which is necessary for stable binding of PsaH and PsaL to PSI

  • These interactions are critical for forming the LHCII docking site in plants

  • PsaL coordinates four carotenoids, suggesting a role in protection against reactive oxygen species

How does PsaL contribute to PSI stability under environmental stress conditions?

PsaL plays a critical role in maintaining PSI stability under various environmental stressors. Transplastomic knockout studies in tobacco (Nicotiana tabacum) have demonstrated that:

Under normal growth conditions: PsaL-deficient mutants show minimal phenotypic differences compared to wild-type plants, suggesting redundant stabilization mechanisms during optimal conditions .

Under stress conditions: PsaL becomes essential, with knockout mutants exhibiting:

  • Reduced PSI content during high-light exposure

  • Decreased stability during chilling stress

  • Accelerated degradation during leaf senescence

This context-dependent importance suggests that PsaL may function as a "stress shield" for PSI, providing structural reinforcement when the complex is under environmental pressure. The mechanism likely involves stabilizing interactions with other PSI subunits and potentially coordinating protective carotenoids that mitigate reactive oxygen species damage .

What experimental approaches can distinguish between direct and indirect effects of PsaL on PSI function?

Distinguishing direct from indirect effects of PsaL on PSI function requires multifaceted experimental designs:

  • Time-resolved spectroscopy: Measure electron transfer kinetics from plastocyanin to ferredoxin in wild-type versus PsaL-mutants to assess direct effects on redox reactions

  • Targeted mutagenesis: Introduce specific amino acid substitutions in key PsaL domains rather than complete deletion to identify functional motifs

  • Conditional expression systems: Use inducible promoters to control PsaL levels at different developmental stages or under different stress conditions

  • Synthetic biology approaches: Employ standardized genome architecture (SEGA) methodologies for precise genetic manipulation without disrupting surrounding gene expression

  • Complementation matrix experiments: Test the ability of different PsaL variants to rescue phenotypes in PsaL-deficient backgrounds

Research indicates that while PsaL mutants show reduced PSI content under stress, the remaining PSI complexes maintain normal function in terms of plastocyanin oxidation and electron flux through PSI, suggesting PsaL's primary role is structural stabilization rather than direct involvement in electron transport .

How can recombinant PsaL be utilized for structure-function relationship studies?

Advanced structure-function studies of PsaL can be conducted through systematic domain swapping and mutagenesis approaches:

  • Chimeric protein construction: Create fusion proteins containing domains from PsaL of different species (e.g., cyanobacterial and plant PsaL) to identify functional domains responsible for specific properties

  • Proline-rich motif analysis: Targeted mutagenesis of the conserved proline-rich motifs (NPPxP followed by PNPP) found in the loop between transmembrane helices 2 and 3 can reveal their role in oligomerization state determination

  • Cryo-EM structural studies: Recent advances in cryo-electron microscopy enable high-resolution structural analysis of membrane protein complexes with minimal sample requirements

  • In silico molecular dynamics simulations: Computational approaches can predict how specific mutations affect PsaL structure and interactions within the PSI complex

These approaches have revealed that subtle changes in PsaL structure can dramatically alter PSI organization, as demonstrated by studies where replacing cyanobacterial PsaL with versions from TS-821 or Arabidopsis resulted in monomerization of normally trimeric PSI despite proper PsaL incorporation .

What challenges exist in correlating in vitro studies of recombinant PsaL with in vivo function?

Several methodological challenges complicate the translation of in vitro findings to in vivo understanding of PsaL function:

  • Membrane environment differences: In vitro systems rarely replicate the complex lipid environment of thylakoid membranes, which can affect protein folding and interaction

  • Co-factor coordination: PsaL coordinates carotenoids in vivo that may be absent in recombinant systems, potentially altering structure and stability

  • Post-translational modifications: Potential regulatory modifications present in vivo may be absent in recombinant systems

  • Assembly pathway recapitulation: The stepwise assembly of PSI occurring in vivo involves assembly factors that may be absent in vitro

  • Temporal and spatial regulation: The sub-cellular localization of FtsH proteases involved in PSI maintenance creates distinct microenvironments that are difficult to reproduce in vitro

Researchers are addressing these challenges through approaches like standardized genome architecture (SEGA) that enable precise genomic integration of recombinant variants, providing a more authentic cellular context for functional studies .

How has the structure and function of PsaL evolved across photosynthetic organisms?

The evolutionary trajectory of PsaL reveals fascinating adaptations across photosynthetic lineages:

Evolutionary StagePsaL CharacteristicsFunctional Significance
CyanobacteriaMediates PSI trimerization/tetramerizationOptimizes light harvesting in aquatic environments
Green AlgaeTransitional featuresAdaptation to more variable light conditions
Land PlantsLost trimerization function, gained LHCII binding capabilityAdaptation to terrestrial light environments and development of state transitions

Phylogenetic analysis of PsaL sequences demonstrates that distinct clades exist, including specialized versions that respond to far-red light . The functional shift from mediating PSI oligomerization in cyanobacteria to facilitating state transitions in plants represents a key adaptation in the evolution of photosynthesis on land, enabling more dynamic responses to fluctuating light conditions .

What methodological approaches best reveal the relationship between PsaL sequence variations and functional differences?

Investigating the relationship between PsaL sequence diversity and functional variation requires integrated methodological approaches:

  • Comparative genomics: Analyze PsaL sequences across diverse photosynthetic organisms to identify conserved motifs and lineage-specific variations

  • Maximum-likelihood phylogenetic analysis: Construct evolutionary trees to map functional transitions to sequence divergence events, as demonstrated in studies identifying distinct clades of far-red light responsive forms of PsaL

  • Ancestral sequence reconstruction: Synthesize predicted ancestral PsaL sequences to test hypotheses about evolutionary transitions

  • Heterologous expression studies: Express PsaL variants from diverse organisms in a common host to directly compare functional properties

  • LOGO plot analysis: Generate sequence logos from aligned PsaL sequences to identify conserved motifs associated with specific functions, such as the proline-rich motifs associated with PSI oligomerization states

These approaches have revealed that subtle sequence differences, particularly in the loop region between the second and third transmembrane helices, can dramatically alter PsaL function with respect to PSI oligomerization .

What spectroscopic methods are most informative for analyzing recombinant PsaL integration into PSI complexes?

Advanced spectroscopic techniques provide unique insights into PsaL incorporation and function within PSI:

  • Circular dichroism (CD) spectroscopy: Monitors secondary structure formation to confirm proper folding of recombinant PsaL

  • Fluorescence lifetime imaging microscopy (FLIM): Measures changes in energy transfer efficiency when PsaL is properly integrated into PSI

  • Electron paramagnetic resonance (EPR): Detects changes in the electronic environment of PSI cofactors that may be influenced by PsaL binding

  • Time-resolved absorption spectroscopy: Measures electron transfer kinetics to determine if PsaL incorporation affects PSI function

  • Resonance Raman spectroscopy: Provides information about carotenoid coordination by PsaL through vibration-specific signatures

These techniques have been particularly valuable in demonstrating that while PsaL is not required for the redox reactions of PSI (neither plastocyanin oxidation nor processes at the PSI acceptor side are impaired in knockout mutants), it is essential for structural stability under stress conditions .

How can proteomics approaches enhance our understanding of PsaL interactions and modifications?

Advanced proteomics provides powerful tools for investigating PsaL's role in PSI:

  • Crosslinking mass spectrometry (XL-MS): Identifies direct protein-protein interaction sites between PsaL and other PSI subunits

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps structural dynamics and conformational changes in PsaL under different conditions

  • Top-down proteomics: Characterizes intact PsaL to identify post-translational modifications that may regulate function

  • Quantitative proteomics: Monitors changes in the PSI subunit stoichiometry in response to PsaL modifications or environmental conditions

  • Thermal proteome profiling: Assesses protein thermal stability changes to detect altered protein-protein interactions involving PsaL

Proteomics has revealed important findings, including confirmation that the same PsaL isoform can be present in both tetrameric and trimeric PSI forms in certain cyanobacterial strains, indicating that while PsaL is necessary for oligomerization, additional factors influence the specific oligomeric state adopted .

What are the unresolved questions about PsaL function that require new methodological approaches?

Despite significant advances, several fundamental questions about PsaL remain unanswered:

  • Regulatory mechanisms: How is PsaL expression and turnover regulated in response to environmental cues? New approaches combining transcriptomics with proteomics under varied conditions may provide insights.

  • Post-translational modifications: Do modifications of PsaL occur in vivo that regulate its function? Advanced mass spectrometry techniques detecting modifications in membrane proteins will be essential.

  • Protein-lipid interactions: How do specific lipids in the thylakoid membrane environment influence PsaL structure and function? Native mass spectrometry and lipid analysis of purified complexes could address this question.

  • Dynamic structural changes: Does PsaL undergo conformational changes during state transitions or stress responses? Time-resolved structural techniques like TR-FRET or HDX-MS would be valuable.

  • Evolutionary intermediates: What structural features enabled the transition from oligomerization functions to state transition functions? Synthetic biology approaches creating PsaL variants with intermediate properties could provide insights.

How might advances in synthetic biology techniques improve functional analysis of recombinant PsaL variants?

Emerging synthetic biology approaches offer powerful new tools for PsaL research:

  • Standardized Genome Architecture (SEGA): This platform enables efficient swapping of functional modules directly in the genome without antibiotic markers, allowing rapid testing of PsaL variants in a chromosomal context .

  • Green-white colony screening: This visual method facilitates identification of successful recombinants without complex selection systems, simplifying the workflow for testing multiple PsaL variants .

  • Landing pad technology: Genomic landing pads with standardized homology regions enable reusable integration sites for testing PsaL variants and minimize context-dependent effects .

  • Multigene expression optimization: The XylS/Pm regulator/promoter system can be modified through combinatorial mutagenesis to achieve desired expression profiles for PsaL and interacting partners .

  • Orthogonal translation systems: Incorporation of non-canonical amino acids at specific positions in PsaL could enable precise probing of structure-function relationships and create novel spectroscopic handles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.