Recombinant Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function of CP47

CP47 is a transmembrane chlorophyll-binding protein integral to PSII. It acts as an inner antenna, transferring light energy to the reaction center while stabilizing the Mn₄CaO₅ cluster essential for water oxidation . The psbB gene encodes a polypeptide with six transmembrane helices, featuring conserved histidine residues that coordinate chlorophyll molecules . Recombinant CP47 retains these functional properties, enabling structural and mechanistic studies.

Production of Recombinant CP47

Recombinant CP47 is synthesized using heterologous expression systems, primarily Escherichia coli, to enable large-scale purification and functional studies.

  • Lyophilized forms are reconstituted in deionized water or glycerol-containing buffers to maintain stability .

  • Tags (e.g., His-tag) facilitate affinity chromatography but may require removal for functional assays .

Role in PSII Assembly

  • Chlorophyll Insertion: CP47 associates with ribosomes and the SecY translocon during translation. Pam68 stabilizes nascent CP47, enabling chlorophyll integration prior to PsbH binding .

  • Module Formation: CP47 forms a pre-complex with PsbH, PsbL, and PsbT, which later integrates with D1/D2 reaction center modules .

  • Mutational Studies: R448G mutation in Synechocystis CP47 reduces PSII activity by 45%, highlighting the importance of the extrinsic E-loop for photoprotection .

Biotechnological Relevance

Recombinant CP47 is pivotal for:

  • Photosynthesis Research: Elucidating chlorophyll-protein interactions and energy transfer mechanisms .

  • Drug Discovery: Screening herbicides targeting PSII assembly .

  • Synthetic Biology: Engineering robust photosynthetic systems in crops .

Challenges and Future Directions

  • Stability Issues: Recombinant CP47 requires glycerol or trehalose to prevent aggregation .

  • Functional Complexity: Interactions with auxiliary proteins (e.g., Psb27, Psb35) necessitate co-expression systems for in vitro reconstitution .

  • Unresolved Questions: The exact role of Psb28 in photoprotection and the structural dynamics of chlorophyll insertion remain under investigation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Amborella trichopoda
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLASIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGTGLAENLSLSE AWSKIPDKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNRVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQIV
Uniprot No.

Target Background

Function
Recombinant Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the core complex in Photosystem II (PSII). It binds chlorophyll and facilitates the primary light-induced photochemical processes within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from water, generating oxygen (O2) and a proton gradient. This gradient is subsequently utilized for ATP formation.
Database Links

KEGG: atr:2546567

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CP47 in Photosystem II?

CP47 functions as an inner antenna protein in Photosystem II, playing a crucial role in capturing and transferring light energy to the reaction center. Structurally, CP47 contains six transmembrane domains (TMDs) which form three extrinsic loop regions on the lumen side of the protein . The largest loop (E loop) between the fifth and sixth TMD contains approximately 200 amino acids . This intrinsic subunit binds 16 chlorophyll molecules and several β-carotene molecules, facilitating light harvesting and energy transfer .

The protein has been hypothesized to be involved in binding reaction center chlorophyll, though its exact role in this function continues to be investigated . In spinach PSII, the E loop of CP47 interacts with luminal extrinsic proteins PsbP, PsbO, and PsbTn, as well as with the luminal loop of D2 . Two small membrane-intrinsic subunits, PsbH and PsbL, associate with CP47 and further interact with D2, creating an interconnected protein network within the photosystem .

How conserved is CP47 across different species?

Comparative genomic analyses reveal significant conservation of CP47 across photosynthetic organisms, suggesting its evolutionary importance. Sequence analysis between cyanobacterium Synechocystis 6803 and spinach shows that while the DNA sequence of the psbB gene is 68% homologous, the predicted amino acid sequence demonstrates a higher conservation at 76% homology . This higher protein-level conservation indicates selective pressure to maintain functional domains despite nucleotide variations.

The hydropathy patterns of Synechocystis and spinach CP47 are almost indistinguishable, indicating the same general CP47 folding pattern in the thylakoid membrane across these evolutionarily distant species . This structural conservation extends to functional domains, including the five pairs of histidine residues in CP47 that are spaced by 13 or 14 amino acids and located in hydrophobic regions of the protein . These conserved histidine residues are likely involved in chlorophyll binding, representing a fundamental aspect of CP47 function maintained throughout evolution.

What experimental evidence confirms the importance of CP47 in Photosystem II functionality?

Multiple lines of experimental evidence confirm CP47's essential role in Photosystem II. Gene interruption studies provide compelling evidence of CP47's necessity for photosystem function. When the psbB gene is interrupted by inserting a DNA fragment carrying a kanamycin resistance gene, there is a complete loss of Photosystem II activity . This indicates that an intact CP47 is absolutely required for a functional Photosystem II complex, though it does not necessarily confirm that this protein houses the reaction center .

What expression systems are optimal for producing recombinant CP47?

Recombinant Photosystem II CP47 chlorophyll apoprotein can be successfully produced using various expression systems, with E. coli being a common host for laboratory-scale production . When working with this expression system, researchers should optimize codon usage for the heterologous expression of this plant protein in the bacterial system. The recombinant protein is typically produced using cutting-edge biotechnology techniques that harness genetic engineering to isolate and express the psbB gene .

For researchers seeking alternative expression systems, successful production has been reported from various photosynthetic organisms including the red alga Porphyra yezoensis and the higher plant Lactuca sativa (lettuce) . These systems may offer advantages in terms of post-translational modifications or protein folding that more closely resemble the native state. Regardless of the expression system, optimized production processes are essential to ensure high-quality protein with acceptable purity and functionality for downstream experimental applications.

What are the optimal storage conditions for maintaining CP47 stability and activity?

Proper storage conditions are critical for maintaining the stability and activity of recombinant CP47. The protein should be stored in a specialized Tris-based buffer with 50% glycerol, which has been optimized specifically to maintain protein integrity . This formulation helps prevent protein denaturation and preserves structural elements necessary for experimental applications.

For short-term storage, the protein can be maintained at -20°C, but for extended preservation, storage at -80°C is recommended . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles . It is strongly advised to avoid repeated freezing and thawing as this can significantly compromise protein structure and functionality . The implementation of these storage protocols is essential to ensure experimental reproducibility and reliable results when working with this photosynthetic protein.

Storage DurationRecommended TemperatureBuffer Composition
Short-term (< 1 month)-20°CTris-based buffer with 50% glycerol
Long-term (> 1 month)-80°CTris-based buffer with 50% glycerol
Working aliquots (≤ 1 week)4°CTris-based buffer with 50% glycerol

What quality control methods should be employed to verify recombinant CP47 integrity?

Multiple analytical techniques should be employed to verify the integrity and functionality of recombinant CP47 preparations. Size-exclusion chromatography can assess protein aggregation and oligomeric state, while spectroscopic methods can verify proper folding and chlorophyll binding. Absorption spectroscopy should show characteristic peaks indicating bound chlorophyll molecules, as CP47 binds 16 chlorophyll and several β-carotene molecules in its native state .

Functional assays are equally important for quality control. Since CP47 is involved in energy transfer within PSII, fluorescence measurements can provide insights into its functionality. Researchers should also consider circular dichroism (CD) spectroscopy to analyze secondary structure elements, ensuring proper protein folding. Additionally, limited proteolysis followed by mass spectrometry analysis can verify the presence of key structural domains, including the transmembrane regions and the large E loop that interacts with other PSII components .

How can researchers effectively incorporate recombinant CP47 into membrane systems for functional studies?

For functional studies, researchers need effective methods to incorporate recombinant CP47 into membrane systems that mimic its native environment. Liposome reconstitution represents one approach, where the purified protein is incorporated into preformed liposomes composed of thylakoid-mimicking lipids such as monogalactosyldiacylglycerol (MGDG) and digalactosyldiacylglycerol (DGDG). This technique allows for controlled studies of CP47's interaction with other PSII components and its role in energy transfer.

Nanodiscs technology offers another promising approach, where CP47 is incorporated into disc-shaped lipid bilayers stabilized by membrane scaffold proteins. This system provides a native-like membrane environment while maintaining the protein in a monodisperse state suitable for various biophysical techniques. For researchers interested in studying CP47 within the context of the complete PSII complex, it may be necessary to co-express or co-reconstitute it with other components like D1, D2, and CP43, as CP47 forms part of the "RC47 subcomplex" during PSII assembly .

What methods are used to study CP47-chlorophyll interactions and energy transfer?

The study of CP47-chlorophyll interactions and energy transfer processes requires sophisticated spectroscopic techniques. Time-resolved fluorescence spectroscopy allows researchers to monitor energy transfer kinetics within CP47 and between CP47 and other PSII components. By using ultrafast laser pulses, researchers can track the movement of excitation energy through the protein with picosecond or femtosecond resolution, providing insights into the efficiency and directionality of energy transfer.

Resonance Raman spectroscopy offers complementary information by probing the vibrational modes of chlorophyll molecules bound to CP47. This technique can distinguish between different chlorophyll binding sites based on their unique vibrational signatures. Additionally, site-directed mutagenesis of the five pairs of histidine residues spaced by 13 or 14 amino acids in hydrophobic regions can be employed to test their proposed role in chlorophyll binding . By systematically altering these residues and measuring changes in chlorophyll binding and energy transfer efficiency, researchers can map the functional importance of specific amino acids in CP47-chlorophyll interactions.

What protein-protein interaction techniques are suitable for studying CP47's role in PSII assembly?

Understanding CP47's interactions with other PSII components during assembly requires specialized protein-protein interaction techniques. Cross-linking mass spectrometry (XL-MS) provides a powerful approach to map the interaction interfaces between CP47 and its binding partners. This technique involves chemically cross-linking proteins in their native state, followed by proteolytic digestion and mass spectrometric analysis to identify cross-linked peptides that were in close proximity.

Co-immunoprecipitation (Co-IP) coupled with western blotting can verify interactions between CP47 and other PSII subunits or assembly factors. This approach is particularly valuable for studying interactions with the small membrane-intrinsic subunits PsbH and PsbL that associate with CP47 and further interact with D2 . For researchers interested in the kinetics of PSII assembly, pulse-chase experiments combined with blue native gel electrophoresis can track the incorporation of newly synthesized CP47 into various assembly intermediates. These techniques have revealed that CP47 joins the reaction center to form the "RC47 subcomplex," which is followed by the addition of PsbH, PsbR, and PsbTc .

How do auxiliary proteins like FPB1 and PAM68 facilitate CP47 biogenesis?

Recent research has uncovered a complex network of auxiliary proteins that facilitate CP47 biogenesis. FPB1 (Facilitator of PsbB biogenesis1) works synergistically with PAM68 (Photosynthesis Affected Mutant68) to assist in the proper biogenesis of CP47 . Ribosome profiling studies have revealed increased ribosome stalling when the last transmembrane domain segment of CP47 emerges from the ribosomal tunnel in mutants lacking these auxiliary factors . This suggests these proteins play a crucial role in co-translational membrane insertion and folding of CP47.

In Synechocystis PCC 6803, the cyanobacterial ortholog of PAM68 has been proposed to facilitate chlorophyll insertion into CP47 . This process appears to be conserved but potentially more complex in higher plants. In the fpb1 mutant, despite enhanced polysome association with psbB transcripts, the rate of CP47 synthesis is reduced to approximately 50% compared to wild-type plants . This paradoxical finding suggests that while translation initiation may be enhanced in the absence of FPB1, elongation or termination of translation is adversely affected. This complex interplay highlights the sophisticated regulation of CP47 biogenesis and the importance of auxiliary factors in ensuring proper protein synthesis, folding, and integration into the thylakoid membrane.

What are the implications of altered CP47 levels for photosynthetic efficiency and photoprotection?

Alterations in CP47 levels have significant implications for both photosynthetic efficiency and photoprotection mechanisms. As CP47 functions as an inner antenna protein binding 16 chlorophyll and several β-carotene molecules, changes in its abundance directly impact light-harvesting capacity and energy transfer to the reaction center . Studies with mutants impaired in CP47 biogenesis show that most PSII subunits accumulate only in PSII monomers and CP43-less PSII complexes, with greatly reduced levels of fully assembled PSII supercomplexes .

The carotenoid molecules associated with CP47 play a dual role in light harvesting and photoprotection. They extend the spectral range of light absorption while also quenching triplet chlorophyll states and scavenging reactive oxygen species. Consequently, decreased CP47 levels may compromise these photoprotective mechanisms. Research with fpb1 mutants has shown that defects in CP47 biogenesis lead to increased sensitivity to high light stress . Furthermore, studies examining lack of CP29 (another antenna protein) have demonstrated effects on PSII quantum efficiency and capacity for non-photochemical quenching (NPQ), suggesting that antenna protein composition broadly influences photoprotection capabilities .

How can site-directed mutagenesis of CP47 advance our understanding of energy transfer in Photosystem II?

Site-directed mutagenesis of CP47 represents a powerful approach to dissect the molecular basis of energy transfer in Photosystem II. By strategically altering specific amino acid residues, researchers can probe their roles in chlorophyll binding, protein-protein interactions, and energy transfer pathways. The five pairs of histidine residues spaced by 13 or 14 amino acids in hydrophobic regions of CP47 are particularly interesting targets, as they are hypothesized to be involved in chlorophyll binding .

Mutagenesis studies can address several fundamental questions:

  • Chlorophyll binding specificity: By substituting histidine residues with non-coordinating amino acids, researchers can determine which sites are essential for binding specific chlorophyll molecules.

  • Energy transfer pathways: Strategic alterations of amino acids near bound chlorophylls can disrupt specific energy transfer steps, allowing mapping of excitation energy flow through the protein.

  • Protein stability and assembly: Mutations in transmembrane domains or interface regions can reveal how specific structural elements contribute to CP47 stability and its integration into the PSII complex.

These mutagenesis approaches, combined with advanced spectroscopic techniques like transient absorption spectroscopy and time-resolved fluorescence, can provide unprecedented insights into the structure-function relationships that govern energy capture and transfer in this critical photosynthetic protein.

What is the relationship between CP47 synthesis regulation and PSII assembly dynamics?

The regulation of CP47 synthesis is intricately linked to PSII assembly dynamics, representing a key control point in photosystem biogenesis. Research with the fpb1 mutant has revealed that while polysome association with psbB transcripts is enhanced in the absence of this auxiliary factor, the actual synthesis rate of CP47 is reduced to approximately 50% compared to wild-type plants . This suggests a complex regulatory mechanism where ribosome stalling during elongation may trigger compensatory increases in translation initiation.

Analysis of thylakoid protein complexes by 2D BN/SDS-PAGE reveals that in fpb1 mutants, most PSII subunits accumulate in the PSII monomer and CP43-less PSII complex, with very little fully assembled PSII . This accumulation pattern suggests that impaired CP47 synthesis creates a bottleneck in PSII assembly, leading to the accumulation of assembly intermediates. Interestingly, higher levels of PSII reaction centers are detected in fpb1 mutants, possibly indicating a compensatory response to the reduced levels of fully assembled PSII .

RNA blot hybridization analyses demonstrate that the expression patterns of chloroplast-encoded psb genes, including psbA, psbB, psbC, psbD, psbEFLJ, and psbKI, remain largely unchanged in fpb1 compared to wild-type plants . This finding indicates that the assembly defect is not due to altered transcription of PSII components but rather stems from post-transcriptional processes specifically affecting CP47 synthesis and integration.

What emerging technologies could enhance our understanding of CP47 structure-function relationships?

Several cutting-edge technologies show promise for advancing our understanding of CP47 structure-function relationships. Cryo-electron microscopy (cryo-EM) with improved resolution now allows visualization of PSII components in near-atomic detail, enabling researchers to precisely map the positions of chlorophyll molecules within CP47 and their spatial relationships to other PSII components. This structural information can inform hypotheses about energy transfer pathways and interaction interfaces.

Single-molecule spectroscopy techniques offer unprecedented insights into the heterogeneity and dynamics of energy transfer processes. By observing individual CP47 proteins or PSII complexes, researchers can detect conformational changes, energy transfer events, and rare or transient states that are obscured in ensemble measurements. These approaches could reveal how structural dynamics impact energy transfer efficiency and how CP47 responds to changing environmental conditions.

How might understanding CP47 contribute to improving photosynthetic efficiency in crops?

Insights into CP47 function could inform strategies for enhancing photosynthetic efficiency in agricultural crops. As a key component of the light-harvesting machinery, CP47 influences the capture and utilization of light energy. By understanding the precise mechanisms of energy transfer within CP47 and between CP47 and the PSII reaction center, researchers might identify rate-limiting steps or inefficiencies that could be targeted for improvement.

Engineering efforts could focus on optimizing CP47 structure to enhance light capture under specific environmental conditions. For instance, modifications to chlorophyll binding sites could alter the spectral properties of CP47, potentially expanding the range of light wavelengths that can be efficiently utilized for photosynthesis. Similarly, strengthening the interactions between CP47 and other PSII components could improve the stability and assembly efficiency of the photosystem, potentially enhancing photosynthetic performance under stress conditions.

Comparative analyses of CP47 sequences across plant species adapted to different environmental niches might reveal natural variations that confer advantages under specific conditions. These insights could guide targeted breeding or engineering approaches to introduce beneficial CP47 variants into crop species. Given the conservation of CP47 across photosynthetic organisms, improvements in understanding this protein have broad implications for enhancing photosynthetic efficiency across diverse crop species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.