Recombinant Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The Photosystem Q(B) protein (PsbA) forms the D1 subunit of PSII, housing the QB plastoquinone-binding site responsible for electron transfer during photosynthesis . Recombinant versions are produced via heterologous expression in E. coli, typically fused with a His-tag for purification . This protein facilitates the two-electron reduction of plastoquinone (PQ) to plastohydroquinone (PQH₂), a process coupled with proton uptake and PQH₂ release into the thylakoid membrane .

Electron Transfer Energetics

  • The midpoint potentials (E) for QB redox couples in Thermosynechococcus elongatus PSII are:

    • E(QB/QB⁻) ≈ 90 mV

    • E(QB⁻/QBH₂) ≈ 40 mV .

  • QB⁻ is thermodynamically stabilized, minimizing back-reactions and reactive oxygen species (ROS) generation .

Proton-Coupled Conformational Changes

  • QB binding induces structural rearrangements in PSII:

    • D1-His215 and D1-Ser264 form hydrogen bonds critical for proton transfer .

    • Water molecules infiltrate the QB site during quinone exchange, enabling PQH₂ release .

Protective Role of Associated Proteins

  • Psb28, a transient assembly factor, binds near the QB site and shields PSII intermediates from oxidative damage .

Comparative Analysis of Recombinant Variants

FeatureS. elongatus QB Protein S. lycopersicum QB Protein
Species-Specific AdaptationsOptimized for cyanobacterial PSIITailored for plant PSII dynamics
ApplicationsMechanistic studies of QB redoxStress-response studies in crops

Research Applications

  • Mechanistic Studies: Used to resolve QB site thermodynamics and electron transfer efficiency .

  • Agricultural Biotechnology: Tomato-derived recombinant QB protein aids in improving PSII resilience under high-light stress .

  • Drug Discovery: Serves as a target for herbicides inhibiting PSII (e.g., atrazine) .

Challenges and Considerations

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; glycerol (5–50%) is recommended for long-term storage .

  • Species-Specific Variations: Functional insights from cyanobacterial models may not fully translate to plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cyanophora paradoxa
Target Names
psbA
Target Protein Sequence
MTATLERNASVSLWEQFCGFITSTENRLYIGWFGVLMFPLLLTATTLFIIAFVAAPPVDI DGIREPVAGSLFYGNNIISGAVIPSSAAIGMHFYPIWEAASLDEWLYNGGPYQFVVMHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMMGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLALWPVVGIWFTALGLSTMAFNLNGL NFNQSVVDSQGRVISTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, cyanelle thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q (B) protein and what role does it play in photosynthesis?

Photosystem Q (B) protein is a critical component of Photosystem II (PSII), which functions as a light-driven water/plastoquinone photooxidoreductase. This system is fundamentally important in the planetary energy cycle, facilitating electron transport from water to plastoquinone. The QB site specifically serves as the binding location for the exchangeable quinone, where the final product of the reaction, plastohydroquinone (PQH2), is formed before being released into the membrane. The QB site then binds a new plastoquinone (PQ) from the membrane pool to continue the photosynthetic process . This electron transfer mechanism is essential for maintaining photosynthetic efficiency and avoiding harmful photoinhibition processes.

What expression systems are most effective for producing recombinant Photosystem Q (B) protein?

Recombinant Photosystem Q (B) protein 1 (psbA1) can be expressed and purified from multiple host organisms, each offering distinct advantages. Escherichia coli and yeast expression systems provide the highest yields and shorter production timeframes, making them particularly suitable for structural studies requiring substantial protein quantities . For applications requiring proper protein folding or functional activity, insect cells with baculovirus vectors or mammalian cell expression systems offer superior post-translational modifications . These more complex eukaryotic systems can ensure that the recombinant protein maintains its native conformation and functional characteristics, though typically at lower yields than bacterial systems.

How is the structure of PsbQ protein related to Photosystem Q functioning?

PsbQ is one of three main extrinsic proteins associated with the oxygen-evolving complex (OEC) of Photosystem II in higher plants and green algae. Structural analyses using Fourier transform infrared (FTIR) and circular dichroic (CD) spectroscopy have revealed that PsbQ is predominantly an alpha-helical protein. FTIR quantitative analyses indicate that PsbQ contains approximately 53% alpha-helix, 7% turns, 14% non-ordered structure, and 24% beta-strand plus other beta-type extended structures . CD analyses suggest an even higher alpha-helical content (approximately 64%), with smaller percentages of beta-strand (approximately 7%) and turns/non-regular structures (approximately 29%) . Computational predictions further suggest that PsbQ contains two distinct structural domains: a major C-terminal domain with four alpha-helices and a minor N-terminal domain with less defined secondary structure that is rich in proline and glycine residues . This structural arrangement is essential for PsbQ's role in maintaining the stability and optimal activity of the oxygen-evolving complex, which ultimately affects electron transport to the QB site.

What are the thermodynamic properties of the QB site in Photosystem II?

  • The semiquinone form (QB- −) exhibits thermodynamic stability

  • The resulting Em QB/QBH2 (approximately 65 mV) is lower than the Em PQ/PQH2 (approximately 117 mV)

  • The difference between these potentials (ΔE ≈ 50 meV) provides the driving force for QBH2 release into the plastoquinone pool

  • PQ binds approximately 50 times more tightly than PQH2 to the QB site

Additionally, the difference between Em QB/QB- − and Em QA/QA- − (from literature) is approximately 234 meV, which corresponds to the driving force for electron transfer from QA to QB . These energetic properties are essential for maintaining proper electron flow through PSII.

How does the redox state of QB affect photodamage mechanisms in Photosystem II?

The redox state of QB plays a significant role in photodamage mechanisms. Research indicates that photodamage can be induced in vitro by excitation of PSII centers with previously reduced primary quinone acceptor (QA), leading to the formation of doubly-reduced QAH2 . This situation can occur when high proton motive force (pmf) slows electron transfer through the b6f complex, resulting in electron accumulation on PSII acceptors.

Further research has shown that the electric field component of pmf (Δψ) alters PSII recombination rates through the P+Pheo− pathway (where P+ is the oxidized primary chlorophyll donor and Pheo is the D1 subunit pheophytin), with increasing dependence on the fraction of QA− . This relationship helps explain the correlation between photoinhibition and QA redox state at increasing light intensities.

How can the QB binding niche be redesigned for specific research applications?

The QB binding niche can be redesigned through targeted mutations to achieve specific research objectives, such as creating biosensors or studying electron transfer mechanisms. In studies with Chlamydomonas reinhardtii, researchers have designed PSII mutants with improved affinity for herbicides like atrazine (ATZ) that bind to the QB pocket . Molecular dynamics (MD) simulations have been instrumental in understanding how these mutations affect binding characteristics.

For example, mutations of phenylalanine at position 265 to serine (F265S) or threonine (F265T) in the D1 protein have produced interesting phenotypes with altered QB site functionality . While these mutants do not fully represent homodimeric reaction centers (as they remain heterodimeric with functional two-electron gates at the QB site), they demonstrate photosynthetic behavior similar to reaction centers lacking driving force for electron transfer from QA to QB. This manifests as very slow photosynthesis in low light conditions but approaches control rates under strong illumination .

The redesign process typically involves:

  • Initial molecular modeling and docking studies to position molecules like ATZ within the QB binding pocket

  • Refinement through energy minimization and restrained MD simulation

  • Site-directed mutagenesis of key residues identified through computational analysis

  • Biophysical characterization of the resulting mutants

This approach allows researchers to create specialized PSII variants with altered quinone binding properties for various applications, from herbicide detection to fundamental studies of electron transport mechanisms.

What methodologies are most effective for evaluating QB binding site mutations?

Evaluating QB binding site mutations requires a multifaceted approach combining computational, biochemical, and biophysical methodologies. Molecular dynamics (MD) simulations have proven particularly valuable for investigating how mutations affect the QB binding pocket's interaction with both natural ligands and experimental molecules like herbicides . In these simulations, parameters such as the electrostatic component of binding energy can be calculated using the formula:

ΔGel = Gel complex − (Gel PSII + Gel ligand)

Where Gel represents the electrostatic energy of the respective components .

Experimental validation of computational predictions typically employs techniques such as:

  • Oxygen evolution measurements using Clark-type electrodes to assess photosynthetic activity

  • Flash-induced fluorescence analysis to examine electron transfer kinetics

  • EPR spectroscopy to detect semiquinone formation and stability

  • Herbicide binding assays for mutants designed to alter herbicide sensitivity

For instance, in studies with Chlamydomonas reinhardtii mutants, researchers placed algal samples (0.2 mg Chl) incubated with phenyl-p-benzoquinone on platinum cathodes covered with cellophane membranes, then measured oxygen evolution in response to short saturating flash sequences from xenon photoflashes . Such methodological approaches provide comprehensive insights into how specific mutations affect QB binding and function.

What spectroscopic techniques yield the most valuable insights into Photosystem Q (B) protein structure and function?

Multiple spectroscopic techniques provide complementary insights into QB structure and function:

EPR Spectroscopy: Particularly valuable for measuring the midpoint potentials of QB redox couples by detecting signals from the semiquinone (QB- −) form. This technique has been used to determine that QB- − is thermodynamically stable with a relatively high potential, minimizing back-reactions and electron leakage to O2 .

Fourier Transform Infrared (FTIR) Spectroscopy: Provides detailed structural information about proteins associated with the QB site. For example, FTIR spectroscopy of PsbQ protein in both H2O and D2O environments has revealed its predominantly alpha-helical structure based on the relative areas of amide I and I' bands .

Circular Dichroic (CD) Spectroscopy: Complements FTIR by providing quantitative assessment of protein secondary structure elements. CD analyses of PsbQ have indicated approximately 64% alpha-helix content, with smaller percentages of beta-strand (~7%) and turns/non-regular structures (~29%) .

Fluorescence Techniques: Methods like pulse-amplitude modulation (PAM) fluorometry enable real-time monitoring of electron transport through the QB site by measuring parameters such as qL (QA redox state) and qI (photoinhibition) .

The combination of these techniques provides a comprehensive understanding of QB structure-function relationships that cannot be achieved with any single method alone.

How can molecular dynamics simulations enhance our understanding of QB binding interactions?

Molecular dynamics (MD) simulations provide crucial atomic-level insights into QB binding interactions that are difficult to obtain experimentally. These computational approaches have been particularly valuable for:

  • Positioning and Refinement: Simulations help position molecules like herbicides (e.g., atrazine) within the QB binding pocket according to docking studies, with structures refined through energy minimization and restrained MD simulation .

  • Binding Energy Calculations: MD simulations enable calculation of binding energies between ligands and the QB site, helping to quantify the strength of interactions and predict how mutations might alter binding affinities .

  • Mutation Effects Prediction: By simulating wild-type and mutant PSII complexes with either QB or other molecules within the binding site, researchers can predict how specific mutations (such as F265S or F265T) will affect binding and function before experimental verification .

  • Dynamic Interactions: Unlike static structural methods, MD simulations reveal the dynamic nature of QB binding, including conformational changes, hydrogen bond formation/breaking, and solvent interactions over time .

A typical MD simulation protocol involves 10 ns simulations of wild-type and mutated variants of PSII complexes with QB or other molecules in the binding site, followed by analysis of the electrostatic and non-electrostatic components of binding energies . These computational approaches have become indispensable for directing experimental efforts and interpreting experimental results in QB research.

How does proton motive force affect QB function and photoinhibition?

The proton motive force (pmf) significantly influences QB function and photoinhibition through several interconnected mechanisms. Research with Arabidopsis mutants (minira lines) has shown that decreasing ATP synthase activity leads to increased pmf, which in turn affects electron transport through the QB site and downstream processes .

Higher pmf slows electron transfer through the cytochrome b6f complex, potentially causing electron accumulation on PSII acceptors including QB. This situation can lead to increased photodamage through multiple pathways:

  • Formation of doubly-reduced QA (QAH2) when PSII centers with previously reduced QA are excited

  • Altered recombination rates through the P+Pheo− pathway, influenced by both QA redox state and the electric field component (Δψ) of pmf

Paradoxically, while increased pmf enhances photoprotective mechanisms like non-photochemical quenching (qE), it can simultaneously increase photoinhibition rates . This contradicts the expectation that photoprotection should prevent photoinhibition and suggests a complex balance between these processes.

Data from experiments with lincomycin (a chloroplast translation inhibitor that blocks PSII repair) revealed that minira lines with low ATP synthase activity and high pmf experienced higher rates of photodamage compared to wild-type plants or mutants with wild-type-like proton conductivity (gH+) . This was reflected in decreased maximal PSII quantum efficiency, reduced capacity to perform charge separation, and significantly lower D1 protein levels . These findings contradict models suggesting that photoinhibition is strictly controlled by repair processes rather than damage rates.

What are the technical challenges in measuring QB redox potentials accurately?

Measuring QB redox potentials accurately presents several technical challenges:

  • Maintaining Physiological Conditions: Ensuring measurements reflect the natural environment of the QB site within the thylakoid membrane requires careful control of pH, ionic strength, and lipid environment .

  • Signal Isolation: EPR signals from QB- − can be difficult to isolate from other radical species in the photosynthetic electron transport chain, requiring sophisticated difference spectroscopy approaches .

  • Temporal Resolution: The transient nature of some QB redox states necessitates rapid measurement techniques that can capture short-lived intermediates .

  • Temperature Dependence: Redox potentials are temperature-dependent, and measurements must account for this variation or be standardized to specific temperatures for meaningful comparisons .

  • Protein Structural Integrity: Ensuring that the protein environment around QB remains intact during measurement is crucial, as structural perturbations can significantly alter redox properties .

Despite these challenges, research using EPR spectroscopy has successfully determined the midpoint potentials of QB redox couples in PSII from Thermosynechococcus elongatus, providing valuable insights into the thermodynamic properties that govern electron transport through this critical site .

How do various expression systems compare for recombinant Photosystem Q (B) protein production?

Different expression systems offer distinct advantages and limitations for recombinant Photosystem Q (B) protein production, as summarized in the table below:

Expression SystemYieldTurnaround TimePost-translational ModificationsFunctional ActivityBest Applications
E. coliHighShortMinimalVariableStructural studies, high-throughput screening
YeastHighShort-MediumModerateGoodBalanced yield and functionality
Insect cellsMediumMediumGoodVery goodFunctional studies requiring proper folding
Mammalian cellsLowLongExcellentExcellentStudies requiring full native activity

The choice of expression system depends on the specific research requirements. For structural investigations requiring large protein quantities, E. coli or yeast systems are preferable. For functional studies where post-translational modifications are critical, insect or mammalian cell systems may justify their lower yields and longer production times .

What are the key midpoint potentials of QB redox couples and their functional significance?

The redox properties of QB are fundamental to understanding electron transport through Photosystem II. Key midpoint potentials and their functional significance are summarized below:

Redox CoupleMidpoint Potential (mV)Functional Significance
QB/QB- −~90Determines driving force for first electron transfer from QA
QB- −/QBH2~40Governs proton-coupled electron transfer and product formation
QB/QBH2~65 (calculated)Compared to PQ/PQH2 (117 mV), provides driving force for QBH2 release
QA/QA- −~-144 (from literature)Difference with QB/QB- − (~234 mV) drives electron transfer

These redox properties explain several important aspects of PSII function:

  • The thermodynamic stability of QB- − minimizes back-reactions and electron leakage to O2

  • The ~50 meV difference between Em QB/QBH2 and Em PQ/PQH2 provides the thermodynamic driving force for QBH2 release into the plastoquinone pool

  • PQ binds approximately 50 times more tightly than PQH2, optimizing PSII function even in the presence of a largely reduced plastoquinone pool

This fine-tuned energetic landscape ensures efficient electron transport while minimizing harmful side reactions that could lead to photodamage.

What emerging technologies might advance our understanding of Photosystem Q (B) protein dynamics?

Several emerging technologies show promise for advancing our understanding of QB protein dynamics:

  • Time-resolved X-ray Crystallography: This technique could provide unprecedented insights into the structural changes that occur during electron transfer through the QB site, capturing intermediate states that have been difficult to characterize with static methods .

  • Cryo-electron Microscopy (Cryo-EM): The rapidly advancing field of cryo-EM offers opportunities to visualize QB binding and electron transfer in near-native environments without the need for crystallization, potentially revealing conformational dynamics that are crucial for function .

  • Advanced Computational Methods: Integration of quantum mechanics/molecular mechanics (QM/MM) approaches with classical MD simulations could provide more accurate descriptions of electron transfer processes and energetics at the QB site .

  • Synthetic Biology Approaches: The development of minimal, synthetic photosystems with engineered QB binding sites could enable systematic investigation of the structure-function relationships that govern electron transport efficiency and susceptibility to photoinhibition .

These technologies, alone or in combination, promise to address current knowledge gaps regarding the dynamic aspects of QB function in photosynthesis, potentially leading to applications in artificial photosynthesis and enhanced crop productivity.

How might understanding QB function contribute to artificial photosynthesis applications?

Understanding QB function has significant implications for artificial photosynthesis applications:

  • Optimized Electron Transport: Knowledge of the precise energetics that enable efficient electron transport through QB could inform the design of synthetic electron transport chains with minimized energy losses .

  • Enhanced Stability: Understanding the mechanisms that protect QB from photodamage could help develop more stable artificial photosynthetic systems capable of sustained operation under varying light conditions .

  • Tunable Redox Properties: The ability to engineer QB binding sites with specific redox properties could enable the development of systems optimized for different applications, from hydrogen production to carbon fixation .

  • Herbicide Resistance: Insights from QB binding site mutations that alter herbicide sensitivity could lead to the development of crop plants with enhanced resistance to specific herbicides, potentially improving agricultural productivity .

  • Biosensor Development: Engineered PSII variants with modified QB binding properties have already shown promise as biosensors for herbicides and other environmental contaminants, a direction that could be further expanded with deeper understanding of QB function .

These applications represent just a few potential ways that fundamental research on QB could translate into practical technologies addressing energy, environmental, and agricultural challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.