Recombinant Photosystem Q (B) protein 2

Shipped with Ice Packs
In Stock

Description

Core Function in Photosynthetic Electron Transport

Photosystem Q(B) protein 2 serves as a critical component of Photosystem II (PSII), which functions as a light-driven water/plastoquinone photooxidoreductase of central importance in the planetary energy cycle . As part of the D1 protein, it forms the core reaction center of PSII, providing the binding site for the exchangeable quinone electron acceptor known as QB .

The QB site, harbored within this protein, is where plastoquinone (PQ) undergoes reduction to plastohydroquinone (PQH2) during the photosynthetic electron transport process. This reduced form is subsequently released into the thylakoid membrane, while another plastoquinone molecule from the membrane pool binds to the vacated QB site, maintaining the continuous electron transport chain .

Redox Properties and Electron Transfer Dynamics

Research has provided detailed insights into the energetics of the exchangeable quinone QB within Photosystem II. Studies using electron paramagnetic resonance (EPR) spectroscopy have measured the midpoint potentials of QB in its different redox forms: E(QB/QB- −) ≈ 90 mV and E(QB- −/QBH2) ≈ 40 mV . These measurements demonstrate that the semiquinone form (QB- −) is thermodynamically stabilized within the protein environment.

The resulting combined midpoint potential E(QB/QBH2) of approximately 65 mV is lower than the midpoint potential of free plastoquinone/plastohydroquinone (approximately 117 mV), creating a driving force of about 50 meV that facilitates the release of QBH2 into the plastoquinone pool . Additionally, this arrangement ensures that plastoquinone (PQ) binds approximately 50 times more tightly than plastohydroquinone (PQH2) to the QB site, optimizing PSII function even in the presence of a largely reduced plastoquinone pool .

Charge Recombination Pathways

Transcriptional Control of psbA2

The psbA2 gene, which encodes Photosystem Q(B) protein 2, is part of a small gene family in cyanobacteria . The expression of psbA genes is tightly regulated, with light-dependent up-regulation being crucial for ensuring proper replacement of the D1 protein, which undergoes rapid turnover under natural conditions .

Recent research has uncovered an interesting regulatory mechanism involving cis-encoded antisense RNAs (asRNAs) named PsbA2R and PsbA3R, which are located in the 5' untranslated region of psbA2 and psbA3 genes respectively . These asRNAs exhibit expression patterns that mirror their target mRNAs—up-regulated by light and down-regulated by darkness.

Role of Antisense RNA in Protein Expression

Studies with PsbA2R-suppressing strains (PsbA2R(-)) have revealed that the amount of psbA2 mRNA was reduced to approximately 50% compared to control strains . This reduction correlated with a 15% decrease in Photosystem II activity and reduced amounts of the D1 protein.

The function of PsbA2R appears to involve stabilization of psbA2 mRNA, particularly when it covers both the AU box and the ribosome-binding site in the 5' untranslated region, as demonstrated by in vitro RNase E assays . This regulatory mechanism adds another layer of complexity to the control of psbA gene expression and highlights the importance of achieving maximum levels of D1 synthesis for optimal photosynthetic performance.

Expression Systems and Purification Methods

Recombinant Photosystem Q(B) protein 2 is typically produced using E. coli expression systems, which allow for cost-effective and scalable production . The addition of histidine tags facilitates efficient purification through affinity chromatography methods. The purified protein is generally supplied as a lyophilized powder with purity exceeding 90% as determined by SDS-PAGE analysis .

Proper storage and handling of the recombinant protein are essential for maintaining its structural integrity and functional properties. Recommendations include avoiding repeated freeze-thaw cycles, storing working aliquots at 4°C for up to one week, and long-term storage at -20°C/-80°C with the addition of glycerol as a cryoprotectant .

Research Applications

Recombinant Photosystem Q(B) protein 2 serves valuable functions in multiple research contexts:

  1. Structural Studies: The recombinant protein enables detailed investigation of the three-dimensional architecture of the QB binding site and how it facilitates electron transport.

  2. Interaction Analysis: Chemical cross-linking combined with mass spectrometry has been used to study transient interactions between various components of Photosystem II, including the binding sites and conformational changes during electron transport .

  3. Mutational Studies: Recombinant versions allow researchers to create specific mutations to examine how alterations in the protein sequence affect function, providing insights into structure-function relationships.

  4. Bioenergetic Research: The recombinant protein facilitates investigations into the energetics of electron transfer and charge recombination pathways in Photosystem II .

Association with Cytochrome b559

Research using chemical cross-linking combined with mass spectrometry has revealed important structural interactions between Psb28 (the only cytoplasmic extrinsic protein in PSII) and cytochrome b559, which consists of alpha and beta subunits that are essential components of the PSII reaction-center complex . This finding helps clarify how various protein components interact within the complex architecture of Photosystem II.

Cytochrome b559, composed of alpha (PsbE) and beta (PsbF) subunits, plays important roles in PSII assembly and photoprotection mechanisms . Understanding these interactions provides insights into how the entire PSII complex is assembled and stabilized during the photosynthetic process.

Integration within Photosystem II Complex

Photosystem II functions as a multiprotein complex with numerous subunits. The D1 protein (including Photosystem Q(B) protein 2) works in concert with other core proteins such as D2 (the Q(A) protein), CP43, and CP47 . This intricate arrangement enables the coordination of various photosynthetic processes, including light harvesting, electron transport, and water oxidation.

The table below outlines key proteins found within the Photosystem II complex and their primary functions:

ProteinFunction
Photosystem Q(B) protein (D1)PSII core reaction centre protein
Photosystem Q(A) protein (D2)PSII core reaction centre protein, needed for assembly of a stable PSII complex
CP47Core antenna (conjugates with chlorophyll; catalyses primary photochemical processes)
CP43Core antenna (conjugates with chlorophyll; catalyses primary photochemical processes)
Cytochrome b559 alpha subunit (PsbE)b-type cytochrome involved in PSII assembly and photoprotection
Cytochrome b559 beta subunit (PsbF)b-type cytochrome involved in PSII assembly and photoprotection
PSII reaction centre H protein (PSII-H)PSII stability and assembly, photoprotection
PSII reaction centre I protein (PSII-I)PSII dimerisation and stability
PSII reaction centre J proteinAssembly of water splitting complex
PSII reaction centre K protein (PSII-K)Plastoquinone binding, dimerisation
PSII reaction centre L proteinDonor side electron transfer, PSII assembly and dimerisation

This coordinated assembly of proteins creates a functional unit capable of harvesting light energy and converting it into chemical energy through electron transport processes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA2; psbA-2; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechococcus elongatus
Target Names
psbA2
Target Protein Sequence
MTTVLQRRQTANLWERFCDWITSTENRLYIGWFGVIMIPTLLAATICFVIAFIAAPPVDI DGIREPVSGSLLYGNNIITAAVVPSSNAIGLHLYPIWDAASLDEWLYNGGPYQLIIFHFL IGIFCYMGREWELSYRLGMRPWIPVAFSAPVAAATAVLLIYPIGQGSFSDGLMLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGALFAAMHGSLVTSSLIRETTETESTNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFAALGISTMAFNLNGF NFNHSVVDAQGNVINTWADIINRANIGIEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of QB in Photosystem II electron transport?

QB serves as the terminal electron acceptor in PSII, accepting two electrons via the primary quinone QA and two protons. The plastoquinone at the QB site undergoes complete reduction to form plastohydroquinone (PQH2), which is subsequently released into the membrane. This process is fundamental to the photosynthetic electron transport chain, allowing electrons derived from water oxidation to enter the plastoquinone pool. The QB binding site coordinates with a non-heme Fe2+ complex that includes D1-His215, D2-His214, D1-His272, D2-His268, and bicarbonate, positioned equidistant from both QA and QB . This arrangement facilitates efficient electron transfer between the quinones while maintaining appropriate redox potential relationships.

What are the redox properties of QB in Photosystem II?

Recent measurements using EPR spectroscopy have determined the midpoint potentials (Em) of QB in PSII from Thermosynechococcus elongatus:

Redox CoupleMidpoint Potential (mV)
QB/QB- −~90 mV
QB- −/QBH2~40 mV
Average (QB/QBH2)~65 mV
PQ pool (PQ/PQH2)~117 mV

The semiquinone intermediate (QB- −) is thermodynamically stable with a relatively high potential. The average redox potential for the complete two-electron reduction (~65 mV) is approximately 50 mV lower than that of the plastoquinone pool (~117 mV), providing a significant driving force for the release of QBH2 into the pool . This thermodynamic relationship is critical for PSII function, as it ensures that electron transfer proceeds forward and optimizes performance even when the plastoquinone pool is significantly reduced.

How does QB binding differ from QA binding in PSII?

Unlike QA, which is permanently bound, QB is exchangeable with the plastoquinone pool in the thylakoid membrane. Research has revealed that the quinone form (QB) binds approximately 50 times more tightly to the QB site than the quinol form (QBH2) . This preferential binding of the substrate (quinone) over the product (quinol) is physiologically significant as it allows PSII to function efficiently even when the plastoquinone pool is substantially reduced. The binding characteristics of QB are tuned to optimize quinone exchange while maintaining sufficient residence time for complete reduction. Additionally, the QB binding site includes specific amino acid residues that facilitate proton transfer during the reduction process, which is not required at the QA site.

What is the energy gap between QA/QA- − and QB/QB- −, and why is it significant?

The energy gap between QA/QA- − and QB/QB- − is approximately 234 meV based on EPR measurements, with functional thermoluminescence studies providing a similar estimate of ≥180 meV . This value is significantly larger than the previously accepted value of ~70 meV. This energy difference represents the driving force for electron transfer from QA- − to QB and is crucial for efficient forward electron transport.

The larger energy gap is physiologically significant for several reasons:

This reassessment of the energetic relationship between QA and QB provides important insights into how PSII has evolved to balance efficient forward electron transfer with minimization of potentially damaging side reactions .

How does the high-Em form of QA contribute to photoprotection?

Under strong light conditions when the plastoquinone pool becomes fully reduced and the QB binding site is unoccupied, QA- − can accumulate in PSII, leading to photoinhibition. Research has revealed that QA can exist in two conformational states with different midpoint potentials: a low-Em form that operates under normal conditions and a high-Em form that becomes important under stress conditions .

The shift to the high-Em(QA) conformation increases the energy gap between QA and Pheophytin D1 (PheoD1), which prevents charge recombination via PheoD1 and subsequent formation of triplet chlorophyll that would generate harmful singlet oxygen. This photoprotection mechanism involves:

  • Formation of a low-barrier hydrogen bond between D2-His214 and QA- −

  • Proton migration toward QA- −, facilitated by the loss of bicarbonate

  • Possible protonation of QA- − to form QAH-

This mechanism is unique to PSII and demonstrates an elegant adaptation that allows photosynthetic organisms to minimize photodamage under high light conditions . The relationship between bicarbonate binding and QA redox properties suggests that CO2 levels might influence this photoprotection mechanism, providing a potential regulatory link between environmental conditions and PSII function.

What is the mechanistic basis for preferential QB over QBH2 binding?

The approximately 50-fold higher binding affinity of QB compared to QBH2 arises from specific thermodynamic tuning of the protein environment. The difference in redox potential between the QB site and the plastoquinone pool (ΔE ≈ 50 meV) determines the ratio of binding constants for the quinone and quinol forms . This preferential binding can be calculated from the difference in redox potential using the following relationship:

KQB/KQBH2 = exp(nFΔE/RT)

Where:

  • KQB and KQBH2 are the binding constants for QB and QBH2, respectively

  • n is the number of electrons (2)

  • F is the Faraday constant

  • R is the gas constant

  • T is the temperature

This binding preference is functionally important because:

  • It ensures rapid release of the product (QBH2) into the membrane

  • It enables efficient binding of new substrate (QB) from the membrane pool

  • It allows PSII to function efficiently even when the plastoquinone pool is highly reduced

  • It minimizes product inhibition that would otherwise slow electron transport

This mechanism represents a critical adaptation that optimizes PSII function across a wide range of physiological conditions .

How can EPR spectroscopy be used to determine QB redox potentials?

EPR (Electron Paramagnetic Resonance) spectroscopy is a powerful technique for studying the redox properties of QB in PSII due to its ability to detect unpaired electrons, such as those in the semiquinone radical (QB- −). A methodological approach for determining QB redox potentials involves:

  • Sample preparation: Isolate PSII complexes from organisms like Thermosynechococcus elongatus and prepare them in buffer systems that allow control of the redox environment.

  • Redox titration protocol:

    • Add appropriate redox mediators covering the potential range of interest

    • Apply controlled potentials using potentiostats

    • Freeze samples at defined potentials for EPR analysis

    • Illuminate samples with a single flash to generate QB- − where appropriate

  • EPR measurements:

    • Record spectra at appropriate temperature (typically 15K for semiquinone signals)

    • Quantify the intensity of the QB- − signal as a function of applied potential

    • Plot the data according to the Nernst equation to determine midpoint potentials

  • Data analysis:

    • Fit the experimental data to appropriate Nernstian curves

    • Apply corrections for potential binding equilibria

    • Resolve the two separate redox couples: QB/QB- − and QB- −/QBH2

This approach has successfully resolved the redox potentials of QB redox couples in PSII, correcting previous anomalous values and providing a more consistent thermodynamic framework for understanding electron transport in PSII .

What techniques are effective for studying the binding dynamics of recombinant QB protein?

Studying the binding dynamics of recombinant QB protein requires a multi-faceted approach:

  • Site-directed mutagenesis:

    • Generate mutations in the D1 protein at residues that interact with QB

    • Express recombinant variants in suitable host systems

    • Purify mutant PSII complexes for comparative binding studies

  • Binding kinetics measurement techniques:

    • Isothermal titration calorimetry (ITC) to determine thermodynamic binding parameters

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Fluorescence quenching assays using quinone analogs with fluorescent properties

  • Structural biology approaches:

    • X-ray crystallography to determine high-resolution structures of QB binding in different states

    • Cryo-electron microscopy for structural analysis in near-native conditions

    • NMR spectroscopy for dynamic binding information in solution

  • Biophysical techniques for functional characterization:

    • Time-resolved spectroscopy to measure electron transfer kinetics

    • Thermoluminescence to assess energy gaps between electron transfer components

    • Electrochemical methods to measure redox potentials directly

By combining these approaches, researchers can develop a comprehensive understanding of how structural modifications affect QB binding dynamics and electron transfer properties. This is particularly valuable when studying how specific amino acid substitutions might alter the preferential binding of QB over QBH2, potentially improving photosynthetic efficiency in engineered systems .

How does the RubA protein interact with D1 during PSII biogenesis?

Recent research has identified that the RubA protein (a photosynthesis-specific rubredoxin-like protein) plays a crucial role in PSII biogenesis, specifically interacting with the D1 protein that forms part of the QB binding pocket. Methodological approaches to study this interaction include:

  • Genetic analysis:

    • Generation of ΔrubA mutants

    • Complementation studies with modified RubA variants

    • Analysis of D1 accumulation in the absence of RubA

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to detect RubA-D1 complexes

    • Two-hybrid assays to map interaction domains

    • Cross-linking coupled with mass spectrometry to identify specific interaction sites

  • Functional assays:

    • Radioactive labeling with [35S]Met/Cys to track protein synthesis and accumulation

    • Analysis of membrane complexes by 2D CN/SDS-PAGE

    • Assessment of PSII assembly intermediates in the presence and absence of RubA

Research indicates that RubA specifically binds to modified D1 (D1mod) and is required at an early stage in PSII biogenesis, potentially playing a role in properly establishing the QB binding environment . This interaction appears to be critical for the formation of the reaction center II (RCII) complex, suggesting that RubA may function as an assembly factor that ensures proper integration of D1 and establishment of the QB binding site during PSII assembly.

How do quinone-protein interactions differ between native and recombinant PSII systems?

Comparing native and recombinant PSII systems reveals several important differences in quinone-protein interactions that must be considered when interpreting experimental results:

ParameterNative PSIIRecombinant PSIIMethodological Implications
Lipid environmentNative thylakoid lipidsHost-dependent lipid compositionRequires lipid supplementation or reconstitution
Post-translational modificationsComplete set of modificationsMay lack specific modificationsNeed for additional processing enzymes
Assembly factorsComplete complementMay lack photosynthesis-specific factorsCo-expression of factors like RubA may be necessary
Redox potential stabilityStable within physiological rangeMay show altered redox propertiesRequires careful redox calibration

When studying recombinant QB binding, researchers should implement several controls:

  • Compare redox properties with native systems using identical methodologies

  • Assess the lipid environment's impact on quinone binding

  • Evaluate the presence and function of assembly factors like RubA

  • Validate findings using multiple complementary techniques

Future improvements in recombinant systems should focus on reconstituting the complete assembly pathway, including all necessary auxiliary factors and post-translational modifications to achieve native-like quinone binding and electron transfer properties .

What are the challenges in measuring pH-dependence of QB redox couples?

Measuring the pH-dependence of QB redox couples presents several methodological challenges:

  • Proton coupling complexity:

    • The QB- −/QBH2 couple involves proton binding events

    • The pKa values of nearby residues (like D1-His215 and D2-His214) influence proton availability

    • Bicarbonate binding affects the local proton environment

  • Experimental considerations:

    • Maintaining protein stability across a wide pH range

    • Distinguishing between direct pH effects on QB and indirect effects via protein conformational changes

    • Accounting for pH-dependent shifts in the potentials of reference electrodes

  • Methodological approach:

    • Prepare PSII samples in buffers covering pH range 5.0-9.0

    • Perform EPR-monitored redox titrations at each pH value

    • Plot midpoint potentials against pH to determine proton coupling

    • Use site-directed mutagenesis to identify specific proton pathways

Research suggests that the pKa values of D1-His215 and D2-His214 are critical for understanding proton-coupled electron transfer to QB. Current evidence indicates that pKa(QB- −/QBH) ≈ pKa(D2-His214-NH/N−) in the absence of bicarbonate, and pKa(QBH−/QBH2) ≈ pKa(D1-His215-NH/N−) in the presence of bicarbonate . These relationships help explain the pH-dependent behavior of QB reduction and the mechanisms of photoprotection through QA redox shifts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.