Recombinant Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

The psbA-encoded D1 protein is a transmembrane subunit of PSII, forming a heterodimer with D2 (PsbD) to bind chlorophylls, pheophytin, and plastoquinones. Key functions include:

  • Electron transport: Mediates charge separation and plastoquinone (Q<sub>B</sub>) binding for electron transfer .

  • Oxygen evolution: Hosts the Mn<sub>4</sub>CaO<sub>5</sub> cluster of the oxygen-evolving complex (OEC) .

  • Herbicide target: Binds triazine and urea-based herbicides, enabling studies on weed-control agents .

Table 1: Recombinant psbA Variants

SpeciesSourceLength (aa)PurityApplicationsReference
Heterocapsa triquetraE. coli1–348>90%Herbicide binding assays
Solanum lycopersicumE. coli2–344>90%PSII assembly studies
Prochlorococcus marinusCell-freeFull-length≥85%Structural biology

Key production challenges include maintaining transmembrane helices and redox-sensitive cofactors in vitro .

Herbicide Resistance Studies

  • Mutations in psbA (e.g., Y112L in Synechocystis) alter QB-site conformation, reducing herbicide affinity and impairing PSII recovery .

  • Recombinant psbA enables high-throughput screening of next-generation herbicides .

Photosynthetic Mechanism Elucidation

  • LPE1 protein in Arabidopsis regulates psbA mRNA translation via redox-sensitive binding to its 5′ UTR, critical for D1 turnover under light stress .

  • Cyanobacterial psbA isoforms (D1:1, D1:2, D1′) optimize PSII function under high light or hypoxia .

Challenges and Future Directions

  • Stability: Recombinant psbA requires glycerol (5–50%) and -80°C storage to prevent aggregation .

  • Functional reconstitution: Incorporation into artificial membranes for electron transport studies remains technically demanding .

  • Biotech potential: Engineered psbA variants could enhance crop resilience or bioenergy systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Tetradesmus obliquus (Green alga) (Acutodesmus obliquus)
Target Names
psbA
Target Protein Sequence
MTAILAKNEASSLWARFCEWITSTENRLYIGWFGVIMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAVVPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFF LGICCYMGREWELSYRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what role does the QB protein play in photosynthesis?

The psbA gene encodes the QB protein (D1 protein), a critical component of photosystem II in oxygenic photosynthetic organisms. This protein plays an essential role in photosynthetic electron transport, serving as the binding site for plastoquinone that accepts electrons from photosystem II. The D1 protein is also notable for being the target of several herbicides that inhibit photosynthesis by directly binding to the photosynthetic apparatus .

In the photosynthetic process, the D1 protein forms part of the reaction center of photosystem II where primary photochemical reactions occur. When the D1 protein is damaged due to photoinhibition, it must be rapidly replaced to maintain photosynthetic efficiency, making the expression regulation of psbA genes crucial for photosynthetic organisms .

How do psbA gene variants differ across photosynthetic organisms?

The number and sequence of psbA genes vary significantly across photosynthetic organisms:

OrganismNumber of psbA GenesKey Characteristics
Anacystis nidulans R23 (psbAI, psbAII, psbAIII)psbAII and psbAIII encode identical proteins; psbAI differs by 25 out of 360 residues
Chlamydomonas reinhardtii1Single psbA gene in chloroplast genome; frequently targeted for genetic manipulation
Synechocystis sp. PCC68031Contains mutations that confer increased heat stability

Research has demonstrated that in Anacystis nidulans R2, each of the three psbA genes is capable of producing sufficient functional QB protein to support normal photoautotrophic growth when other copies are inactivated .

What methodologies are used to study psbA gene expression regulation?

To investigate psbA gene expression regulation, researchers employ several techniques:

  • RT-qPCR analysis to quantify mRNA levels under different conditions (light intensity, temperature, nutrient availability)

  • Reporter gene assays using the psbA promoter and UTRs fused to reporter proteins like GFP or luciferase to visualize expression patterns

  • Western blotting to quantify D1 protein levels and correlate with transcript abundance

  • Antisense RNA studies to investigate post-transcriptional regulation mechanisms

  • Mutagenesis of promoter and UTR regions to identify regulatory elements

When studying the relationship between transcription and translation, researchers have observed poor correlation between mRNA abundance and protein accumulation. For example, in recombinant protein expression studies, HMGB1 mRNA was approximately 75-fold less abundant than VEGF mRNA, yet both proteins accumulated to similar levels (2.5% and 2% of total soluble protein, respectively) .

What techniques are most effective for targeted mutagenesis of the psbA gene?

For targeted mutagenesis of the psbA gene, researchers have developed several effective approaches:

  • Homologous recombination-based methodology: Derived from techniques used in Saccharomyces cerevisiae, this approach has proven effective for Chlamydomonas reinhardtii chloroplast transformation. The procedure involves:

    • Creating a linear DNA fragment containing the desired mutation flanked by homologous sequences

    • Co-transforming this fragment with an antibiotic resistance marker

    • Selecting transformants on antibiotic-containing media

    • Screening for the desired mutation using restriction analysis or PCR-based methods

  • Biolistic transformation protocol: This technique involves:

    • Pre-treatment of cells with 5-fluoro-2′-deoxyuridine (FUDR) to reduce chloroplast DNA copy number

    • Coating gold or tungsten particles with the transforming DNA

    • Accelerating particles into cells using a gene gun

    • Co-transformation with selectable markers (e.g., antibiotic resistance genes)

The efficiency of these approaches can be illustrated by experimental data from a study attempting to replace specific serine residues in the psbA gene of C. reinhardtii:

Transformation ParameterValue
Ratio of mutated fragment to marker plasmid5:2
Selection agentSpectinomycin
PCR fragment size for screening2.7 kb
Expected restriction fragments (WT)1.55 kb and 1.15 kb
Expected restriction pattern (mutant)Uncut 2.7 kb fragment

How can researchers overcome challenges in achieving homoplasmy when modifying the psbA gene?

Achieving homoplasmy (uniform genetic transformation of all chloroplast genome copies) is a significant challenge in psbA modification research. Effective methodologies include:

  • Multiple rounds of selection: Repeated cycles of growth on selective media to eliminate wild-type genome copies and enrich for transformed genomes

  • Reduced copy number approach: Pre-treating cells with FUDR to reduce chloroplast DNA copy number before transformation

  • Dual selection strategy: Using both primary selectable markers (antibiotic resistance) and secondary markers (e.g., altered restriction sites) to facilitate identification of homoplasmic transformants

  • PCR-based screening: Developing sensitive PCR assays that can detect low levels of wild-type sequences in predominantly transformed populations

  • Southern blot analysis: Confirming homoplasmy by analyzing restriction fragment patterns of total chloroplast DNA

Researchers must carefully design experiments to include appropriate control groups and verification steps to ensure complete transformation. This is particularly important when studying mutations that might affect photosynthetic efficiency or competitive fitness .

What approaches are most effective for analyzing the functional consequences of psbA mutations?

To analyze the functional consequences of psbA mutations, researchers employ multiple complementary techniques:

  • Photosynthetic performance measurements:

    • Oxygen evolution rates under different light intensities

    • Chlorophyll fluorescence analysis (Fv/Fm, ΦPSII, NPQ)

    • P700 absorbance changes to assess electron transport rates

    • CO2 fixation rates under varying conditions

  • Stress tolerance assessment:

    • Growth rates under elevated temperatures

    • Recovery from photoinhibition

    • Resistance to specific herbicides

    • Response to oxidative stress conditions

  • Biochemical characterization:

    • Protein turnover rates using pulse-chase experiments

    • Binding affinities for plastoquinone and herbicides

    • Structural analysis using crystallography or cryo-EM

    • Redox properties of the modified reaction centers

  • Comparative growth studies:

    • Competition experiments between mutant and wild-type strains

    • Growth under fluctuating environmental conditions

    • Long-term cultivation to assess genetic stability

When attempting to introduce mutations that confer thermotolerance, researchers must systematically evaluate growth parameters across a temperature gradient while monitoring photosynthetic efficiency to establish the functional significance of the modifications .

How can the psbA promoter and UTRs be optimized for maximal recombinant protein expression?

The psbA promoter and untranslated regions (UTRs) have emerged as powerful tools for high-level expression of recombinant proteins in algal chloroplasts. Optimization strategies include:

  • Knockout-replacement strategy: Replacing the endogenous psbA gene with the recombinant gene can yield expression levels as high as 20.9% of total cell protein for certain recombinant proteins

  • Light-responsive expression: Increasing light intensity enhances expression from the psbA promoter, allowing for inducible protein production

  • Fusion protein approach: Creating fusions with well-expressed proteins like mammalian serum amyloid protein (M-SAA) can enhance expression. This strategy typically includes:

    • Fusion of the target protein to the C-terminus of M-SAA

    • Inclusion of a protease cleavage site (e.g., thrombin) between the fusion partners

    • Placement under control of the psbA promoter and UTRs

  • UTR engineering: Modifying the 5' and 3' UTRs to enhance mRNA stability and translation efficiency

  • Codon optimization: Adapting the coding sequence to match the codon preference of the chloroplast genome

The following table summarizes expression levels achieved with different strategies:

Expression StrategyModel ProteinExpression LevelKey Features
psbA replacementVP28 (WSSV)20.9% total cell proteinNon-photosynthetic strain
psbA UTRs with M-SAA fusionVarious therapeutic proteins~10% total soluble proteinPhotosynthesis can be restored
atpA promoterVariousLower than psbAAlternative for maintaining photosynthesis

What methodological approaches enable simultaneous high recombinant protein expression and photosynthetic growth?

Achieving high recombinant protein expression while maintaining photosynthetic competence is crucial for sustainable production systems. Effective methodologies include:

  • Two-gene approach: This strategy involves:

    • Replacing the endogenous psbA gene with the recombinant gene

    • Reintroducing the psbA gene elsewhere in the genome under control of another promoter (e.g., psbD)

    • This approach maintains high recombinant protein levels while restoring photosynthesis

  • Alternative integration sites: Using integration sites other than the psbA locus, such as:

    • The inverted repeat region downstream of the psbA locus

    • Silent spacer regions between functional genes

    • These sites allow recombinant gene expression without disrupting essential photosynthetic genes

  • Alternative promoter-UTR combinations: The atpA and psbD promoters and UTRs have shown good expression while preserving photosynthetic capability

  • Inducible expression systems: Developing light-intensity or temperature-regulated expression systems that allow temporal separation of growth and protein production phases

When using the M-SAA fusion approach with reintroduced psbA under the psbD promoter, researchers observed only slightly reduced recombinant protein levels compared to the psbA-deficient strain, demonstrating the viability of creating photosynthetically competent production strains .

What experimental design considerations are critical when expressing therapeutic proteins using the psbA system?

When designing experiments for therapeutic protein expression using the psbA system, researchers should consider:

  • Protein functionality assessment:

    • Bioactivity assays comparing chloroplast-produced protein to authentic reference standards

    • Structural analysis to confirm proper folding

    • Post-translational modification analysis

  • Expression optimization protocol:

    • Testing multiple constructs with variations in promoters, UTRs, and fusion strategies

    • Screening numerous transformants to identify high-expressing lines

    • Optimizing growth and induction conditions (light intensity, temperature, media composition)

  • Purification strategy development:

    • Inclusion of affinity tags for simplified purification

    • Development of extraction protocols that minimize protease activity

    • Removal of algal compounds that may interfere with therapeutic activity

  • Scale-up considerations:

    • Transition from laboratory to pilot-scale production

    • Consistency of expression across batches

    • Stability of the transgene during prolonged cultivation

  • Regulatory compliance:

    • Documentation requirements for research involving recombinant DNA

    • Implementation of appropriate biosafety measures

    • Preparation for eventual clinical development requirements

For example, when expressing the mammalian serum amyloid protein (M-SAA), researchers confirmed that the purified protein maintained bioactivity similar to the authentic protein, demonstrating that the chloroplast expression system can produce functional mammalian proteins .

What biosafety classifications apply to different types of psbA recombinant research?

Research involving recombinant psbA genes is subject to biosafety regulations that vary depending on the nature of the experiments:

  • Basic recombinant psbA research in non-pathogenic organisms:

    • Typically classified as Biosafety Level 1 (BSL-1)

    • Requires standard microbiological practices

    • May be exempt from NIH Guidelines under certain conditions

  • Gene transfer experiments involving psbA in plants:

    • Generally conducted at BSL-1 or BSL-2

    • May require plant containment facilities

    • Subject to specific sections of the NIH Guidelines

  • Expression of therapeutic proteins using psbA regulatory elements:

    • Classification depends on the nature of the therapeutic protein

    • May require higher biosafety levels if expressing toxins or bioactive proteins

    • Additional containment measures may be needed

  • Human gene transfer protocols using psbA-derived elements:

    • Classified under category III-C of the NIH Guidelines

    • Requires specific documentation of personnel involved in administration of recombinant material

    • Subject to additional institutional and federal oversight

Researchers must consult their Institutional Biosafety Committee (IBC) for guidance on the appropriate biosafety classification for their specific research projects .

What documentation is required when conducting recombinant DNA research with psbA genes?

For research involving recombinant psbA genes, required documentation typically includes:

  • Recombinant DNA Registration Document (rDNARD):

    • Project description including specific manipulations of psbA genes

    • Personnel information (principal investigator and key research staff)

    • Risk assessment and containment measures

    • Emergency procedures

  • Personnel documentation requirements:

    • For human gene transfer protocols (category III-C), only principal investigator and those directly involved in administering recombinant material need to be listed by name

    • Other personnel can be listed by job title

  • Protocol-specific information:

    • Detailed experimental procedures

    • Source and characteristics of DNA sequences

    • Host organisms and vectors

    • Expected outcomes and potential hazards

  • Biosafety assessment:

    • Analysis of potential risks to laboratory workers, public, and environment

    • Justification for proposed biosafety level

    • Description of laboratory facilities and equipment

Researchers should maintain comprehensive records of all experiments involving recombinant psbA genes, including transformation procedures, selection methods, and confirmation of genetic modifications .

How can researchers ensure compliance with international regulations when collaborating on psbA research?

Ensuring regulatory compliance in international psbA research collaborations requires:

  • Regulatory framework comparison:

    • Analyze regulations in all participating countries

    • Identify the most stringent requirements across jurisdictions

    • Develop protocols that satisfy all applicable regulations

  • Material transfer considerations:

    • Establish appropriate Material Transfer Agreements (MTAs)

    • Ensure compliance with import/export regulations for transgenic organisms

    • Document all transfers of recombinant materials

  • Standardized documentation practices:

    • Develop shared templates for experimental procedures

    • Maintain consistent record-keeping across all research sites

    • Establish clear communication channels for regulatory updates

  • Collaborative oversight mechanisms:

    • Regular meetings of biosafety officers from participating institutions

    • Joint review of experimental protocols

    • Coordinated reporting of any accidents or incidents

  • Training and competency verification:

    • Ensure all personnel receive appropriate biosafety training

    • Verify understanding of regulatory requirements

    • Document training completion across all research sites

By implementing these practices, researchers can navigate the complex regulatory landscape of international collaborations while maintaining compliance with all applicable regulations .

How should researchers interpret discrepancies between psbA transcript levels and protein accumulation?

Discrepancies between psbA transcript levels and protein accumulation are common and require sophisticated analytical approaches:

  • Multi-level analysis framework:

    • Measure transcript abundance using RT-qPCR

    • Quantify protein levels using Western blotting or mass spectrometry

    • Assess protein synthesis rates using pulse-labeling techniques

    • Determine protein degradation rates using chase experiments

  • Translation efficiency evaluation:

    • Polysome profiling to assess ribosome loading on mRNAs

    • Ribosome footprinting to identify translation initiation sites and pauses

    • Analysis of sequence features affecting translation efficiency

When interpreting data, researchers should consider cases like the psbA-HMGB1 transcript, which was approximately 75-fold less abundant than psbA-VEGF transcript, yet both proteins accumulated to similar levels (2.5% and 2% of total soluble protein, respectively). This indicates that post-transcriptional mechanisms significantly influence final protein accumulation .

What statistical approaches are most appropriate for analyzing psbA mutation effects on photosynthetic performance?

When analyzing the effects of psbA mutations on photosynthetic performance, researchers should employ the following statistical approaches:

  • Experimental design considerations:

    • Factorial designs to assess interactions between mutations and environmental factors

    • Repeated measures designs for time-course experiments

    • Power analysis to determine appropriate sample sizes

  • Statistical analysis methods:

    • ANOVA with post-hoc tests for comparing multiple treatment groups

    • Mixed-effects models for experiments with random and fixed factors

    • Non-parametric tests when assumptions of normality are violated

    • Regression analysis for dose-response relationships

  • Data visualization strategies:

    • Interaction plots to illustrate how mutations affect responses to environmental factors

    • Heat maps to display complex datasets with multiple variables

    • Time-series plots for tracking changes in photosynthetic parameters

When reporting results, researchers should clearly state both statistical significance (p-values) and effect sizes to convey the biological relevance of their findings .

How can researchers effectively compare expression levels across different psbA-based expression systems?

Effective comparison of expression levels across different psbA-based systems requires standardized methodologies:

  • Normalization strategies:

    • Express recombinant protein levels as percentage of total soluble protein (TSP) or total cell protein (TCP)

    • Use standardized reference proteins for Western blot quantification

    • Employ absolute quantification using purified protein standards

  • Multi-factor analysis framework:

    • Systematically evaluate effects of promoter, UTRs, integration site, and host strain

    • Control for environmental conditions (light intensity, temperature, media composition)

    • Consider growth stage and physiological status of cultures

The following comparative data illustrates expression levels achieved with different strategies:

Expression SystemRegulatory ElementsIntegration StrategyExpression LevelPhotosynthetic Status
pD1-Kan vectorpsbA promoter & UTRspsbA replacementUp to 20.9% TCPNon-photosynthetic
psbA::SAA fusionpsbA promoter & UTRspsbA replacement~10% TSPNon-photosynthetic
p322 plasmidatpA promoter, rbcL 3' UTRSilent site integrationLower than psbAPhotosynthetic
psbA reintroductionpsbD promoterSecondary integrationMaintains high expressionPhotosynthetic

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.