Recombinant Photosystem Q (B) protein (psbA1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant psbA1 is synthesized using cell-free systems, which bypass cellular limitations like low yield or toxicity. Key steps include:

  1. Cloning: psbA1 is cloned into expression vectors for high-fidelity transcription.

  2. Expression: Cell-free systems (e.g., E. coli lysate) optimize protein folding and solubility.

  3. Purification: Affinity chromatography isolates the protein for downstream applications.

This method enables precise control over post-translational modifications, such as phosphorylation (e.g., PsbA-P), which regulates PSII repair cycles .

Functional Roles in Photosynthesis

psbA1-encoded D1 protein governs PSII’s photochemical reactions:

FunctionMechanism
Water OxidationCoordinates Mn₄CaO₅ cluster; facilitates S-state transitions (S₀–S₄)
Electron TransferBinds Qₐ and Q₆ plastoquinones; mediates charge separation
PhotoprotectionRapid turnover under high light; isoform switching (e.g., D1:1 → D1:2)

In Thermosynechococcus elongatus, psbA1 dominates under moderate light, while psbA3 replaces it under high light/UV stress, altering Qₐ redox potential and charge recombination rates .

Research Applications

Recombinant psbA1 is pivotal in structural and biophysical studies:

ApplicationMethodologyKey Findings
PSII StructureX-ray crystallography, cryo-EMResolved D1 interactions with cofactors
Redox Potential ModulationThermoluminescence, chlorophyll fluorescencePhe186 substitutions lower Eₘ(S₂/Qₐ) by 20–25 mV
Photoprotection StudiesUV-B exposure, high-light treatmentsD1 isoform replacement correlates with stress acclimation

For example, replacing PsbA1 with PsbA3 in Thermosynechococcus reduced S₂Qₐ⁻ recombination rates, enhancing photostability .

Challenges and Limitations

  1. Stability: D1 is prone to photodamage; recombinant forms require stabilization .

  2. Processing Requirements: C-terminal cleavage by CtpA protease is critical for Mn₄CaO₅ binding .

  3. Isoform Specificity: Recombinant psbA1 may not replicate native expression patterns (e.g., light-dependent regulation) .

Future Directions

  • Engineering Photostable D1 Variants: Introducing mutations (e.g., D1′) to enhance tolerance to oxidative stress .

  • Comparative Studies: Analyzing psbA1 vs. sentinel D1 (from Cyanothece) to understand oxygen-sensitive processes .

  • Biotechnological Applications: Optimizing PSII for bioenergy systems or artificial photosynthesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will be incurred.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
psbA1; OtCpg00300; psbA2; OtCpg00610; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Ostreococcus tauri
Target Names
psbA1
Target Protein Sequence
MTATLERRANATVWGRFCSWITSTENRLYIGWFGVLMIPTLLTATSVFIVAFIAAPPVDI DGIREPVSGSLMYGNNIISGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFF IGICSYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAIWPVMGIWFTALGISTMAFNLNGF NFNQSVVDSNGRVINTWADIVNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: ota:OstapCp30

STRING: 70448.Q0P3J1

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q (B) protein (psbA1) and what role does it play in photosynthesis?

Photosystem Q (B) protein, also known as D1 protein and encoded by the chloroplast gene psbA1, is a crucial reaction center protein of Photosystem II (PSII). It serves as an essential component in the biogenesis and functional maintenance of PSII complexes, which function as water-plastoquinone oxidoreductases in the photosynthetic electron transport chain . D1 protein is particularly important for initiating photosynthesis and electron transport, serving as a primary site for light-induced damage and exhibiting high turnover rates under varying light conditions .

How does the psbA1 gene differ across photosynthetic organisms?

While the search results don't provide comprehensive information about psbA1 gene variation across all photosynthetic organisms, we can infer important evolutionary differences in the regulatory mechanisms controlling psbA1 expression. Notably, the regulatory factors involved in D1 protein synthesis during PSII biogenesis appear to have diverged between higher plants and primitive photosynthetic organisms .

For instance, the pentatricopeptide repeat (PPR) protein LOW PHOTOSYNTHETIC EFFICIENCY 1 (LPE1), which plays a crucial role in psbA mRNA translation in Arabidopsis, is found exclusively in land plants . In contrast, HIGH CHLOROPHYLL FLUORESCENCE 173 (HCF173), another regulator of psbA mRNA translation, has homologs in other photosynthetic organisms including algae, though these homologs show low sequence similarity and may have different functions .

This evolutionary divergence suggests that while the core mechanisms regulating D1 synthesis during PSII biogenesis are conserved, higher plants and primitive photosynthetic organisms employ distinct regulatory factors to achieve this regulation.

What methods are recommended for initial characterization of recombinant psbA1 protein?

For initial characterization of recombinant psbA1 protein, researchers should employ a multi-faceted approach:

  • Expression verification: Western blot analysis using antibodies specific to the D1 protein or to affinity tags if the recombinant protein is tagged .

  • Functional assessment: Chlorophyll fluorescence analysis to measure PSII activity, which can reveal whether the recombinant protein maintains photosynthetic functionality .

  • Subcellular localization: Fractionation studies to determine protein distribution between stroma and thylakoids, as D1 synthesis and membrane insertion occur in a concerted manner at the thylakoid membrane .

  • Interaction studies: Co-immunoprecipitation (Co-IP) to identify potential interaction partners, followed by RNA immunoprecipitation (RIP) if RNA-binding activity is suspected .

  • Direct RNA binding assessment: If the protein is suspected to interact with RNA (like the native D1 protein with its mRNA), electrophoretic mobility shift assay (EMSA) with labeled RNA probes corresponding to potential binding regions (e.g., 5' UTR of psbA mRNA) .

These characterization methods would provide fundamental insights into whether the recombinant protein retains the essential properties of native psbA1 protein.

Which expression system yields the highest functional recombinant psbA1 protein?

Multiple expression systems can be used for recombinant Photosystem Q (B) protein production, each with distinct advantages:

The choice of expression system should be guided by research objectives. For structural studies requiring large protein quantities, E. coli or yeast would be preferable. For functional studies where post-translational modifications affect activity, insect or mammalian cell systems would be more appropriate despite their lower yields.

What strategies can overcome inclusion body formation when expressing psbA1 in E. coli?

Inclusion body formation is a common challenge when expressing membrane proteins like psbA1 in E. coli. Several strategies can mitigate this issue:

  • Fusion partners: Employing solubility-enhancing fusion partners can significantly reduce aggregation. Common fusion tags include maltose-binding protein (MBP), glutathione S-transferase (GST), and SUMO, which can enhance solubility and facilitate purification .

  • Expression conditions optimization: Lowering the expression temperature (to 15-25°C), reducing inducer concentration, and using slow induction can decrease inclusion body formation by slowing protein synthesis and allowing more time for proper folding .

  • Specialized E. coli strains: Using strains engineered for membrane protein expression or containing additional chaperones can improve folding. The TatExpress BL21 strain, for example, has been engineered to enhance protein secretion .

  • Co-expression strategies: Co-expressing molecular chaperones or protein folding catalysts can assist in proper protein folding and prevent aggregation .

  • Controlled refolding: If inclusion bodies still form, they can be isolated, solubilized using denaturants (urea or guanidinium hydrochloride), and then refolded through controlled dialysis or dilution protocols.

These approaches should be systematically tested and optimized for recombinant psbA1 expression, potentially combining multiple strategies for best results.

How can post-translational modifications be preserved in recombinant psbA1 protein production?

Preserving post-translational modifications (PTMs) in recombinant psbA1 protein requires careful selection of expression systems and purification strategies:

  • Expression system selection: For PTMs critical to psbA1 function, expression in eukaryotic systems is generally preferred:

    • Insect cells with baculovirus can provide many necessary post-translational modifications for correct protein folding

    • Mammalian cells offer the most comprehensive PTM machinery, capable of executing complex modifications essential for maintaining protein activity

  • PTM-specific optimization:

    • For phosphorylation: Use mammalian or insect cell systems with appropriate kinase co-expression if the specific kinase is known

    • For disulfide bond formation: E. coli strains with oxidizing cytoplasmic environments (such as SHuffle) can be employed for simpler PTM requirements

    • For glycosylation: Yeast, insect, or mammalian cells are required, with mammalian cells providing the most human-like glycosylation patterns

  • Purification considerations:

    • Employ gentle purification conditions to avoid PTM loss

    • Use phosphatase inhibitors during purification if phosphorylation is important

    • Consider native purification approaches rather than denaturing conditions

  • Verification methods:

    • Mass spectrometry to confirm the presence and nature of PTMs

    • Western blotting with PTM-specific antibodies

    • Functional assays comparing activity of recombinant protein versus native protein

This systematic approach ensures that functionally significant post-translational modifications are maintained during recombinant psbA1 production.

How does the psbA1 mRNA interact with regulatory proteins to control translation?

The translation of psbA1 mRNA is regulated through specific RNA-protein interactions, particularly involving the 5' UTR region of the transcript and several regulatory proteins:

  • LPE1 binding mechanism: LOW PHOTOSYNTHETIC EFFICIENCY 1 (LPE1), a pentatricopeptide repeat (PPR) protein, directly binds to the 5' UTR of psbA mRNA . This interaction has been demonstrated through RNA immunoprecipitation (RIP) analysis and electrophoretic mobility shift assay (EMSA) . The binding appears to be specific to psbA mRNA, as LPE1 did not show significant association with other chloroplast transcripts like psbB, psbC, and psbD .

  • HCF173 recruitment: LPE1 interacts with HIGH CHLOROPHYLL FLUORESCENCE 173 (HCF173) and facilitates its association with psbA mRNA . This association forms a regulatory complex that promotes efficient translation of the D1 protein.

  • Light-dependent regulation: The association between LPE1 and psbA mRNA is light-dependent. Experiments showed that LPE1 associated with greater amounts of psbA mRNA following light exposure for various durations (8, 24, or 48 hours) . This light-dependent association provides a mechanism to coordinate D1 protein synthesis with photosynthetic activity.

  • Ribosome loading: The regulatory proteins influence the efficiency of ribosome loading onto psbA mRNA. In LPE1-deficient mutants, polysome association experiments revealed impaired ribosomal loading of psbA mRNA , demonstrating the role of these RNA-protein interactions in translation initiation.

These interactions collectively form a sophisticated regulatory mechanism that controls D1 protein synthesis in response to environmental cues, particularly light conditions.

What experimental approaches can identify and validate RNA-protein interactions involving psbA1 mRNA?

To identify and validate RNA-protein interactions involving psbA1 mRNA, researchers can employ several complementary techniques:

  • RNA Immunoprecipitation (RIP):

    • This technique allows detection of specific RNA-protein interactions in vivo

    • In studies of LPE1, RIP analysis demonstrated that psbA mRNA was enriched in LPE1-FLAG plants compared to wild-type plants

    • The method can be coupled with RT-qPCR for quantification of bound RNA species

  • Electrophoretic Mobility Shift Assay (EMSA):

    • EMSA provides direct evidence of RNA-protein binding in vitro

    • Recombinant protein (e.g., His-tagged fusion protein expressed in E. coli) is incubated with labeled RNA probe

    • The RNA-protein complex migrates more slowly than free probe in gel electrophoresis

    • Specificity can be confirmed through competition experiments with unlabeled probes

  • UV Crosslinking followed by Immunoprecipitation:

    • This approach captures transient RNA-protein interactions through UV-induced covalent bonding

    • It can identify the exact binding sites on the RNA molecule

  • Polysome Association Analysis:

    • Gradient centrifugation separates mRNAs based on their association with ribosomes

    • This technique can reveal how RNA-protein interactions affect translation efficiency

    • In LPE1-deficient plants, impaired ribosomal loading of psbA mRNA was observed

  • RNA Affinity Purification:

    • Biotinylated RNA corresponding to potential binding regions (e.g., 5' UTR) is used as bait

    • Proteins that bind to the RNA can be identified through mass spectrometry

These methods, used in combination, provide robust validation of RNA-protein interactions and their functional significance in regulating psbA1 mRNA translation.

What is the relationship between redox state and psbA1 mRNA translation regulation?

The relationship between redox state and psbA1 mRNA translation regulation represents a sophisticated mechanism linking photosynthetic electron transport to protein synthesis:

  • Redox-dependent RNA binding: The association of LPE1 with psbA mRNA is regulated by the redox state. In vitro EMSA analysis demonstrated that oxidizing agent DTNB (5,5'-Dithiobis(2-nitrobenzoic acid)) decreased the association between LPE1 and psbA mRNA, while the reducing agent DTT restored this association . This suggests that the reduced form of LPE1 preferentially binds to psbA mRNA.

  • Light-induced reduction: Light exposure gradually increases the reduced form of LPE1 protein, as demonstrated by mobility shift assays using AMS (4-acetoamido-4-maleimidylstilbene-2,2-disulfonic acid) . Following 6 or 12 hours of light exposure, the amount of reduced LPE1 protein increased compared to dark conditions .

  • Mechanistic relationship: The redox state appears to function as a molecular switch that transduces light signals into translation regulation:

    • Light activates photosynthetic electron transport

    • This alters the stromal redox state

    • The changed redox environment modifies LPE1 protein

    • Reduced LPE1 binds more efficiently to psbA mRNA

    • This promotes association with HCF173 and enhances D1 protein translation

  • Basal activity in mature chloroplasts: Interestingly, mature chloroplasts maintain a basal level of reduced LPE1 even in dark conditions , explaining why there is still some level of association between LPE1 and psbA mRNA in the dark. This suggests mature chloroplasts possess a basal reducing power in the absence of light.

This redox-dependent regulation provides a direct link between photosynthetic activity and the synthesis of D1 protein, ensuring coordinated replacement of this high-turnover component of PSII.

How can researchers measure and quantify the functional activity of recombinant psbA1 protein?

Assessing the functional activity of recombinant psbA1 protein requires techniques that measure both its integration into PSII complexes and its contribution to photosynthetic function:

  • Chlorophyll fluorescence analysis:

    • A non-invasive technique to assess PSII activity

    • Parameters such as Fv/Fm (maximum quantum efficiency of PSII), NPQ (non-photochemical quenching), and qI (photoinhibition of PSII) provide insights into different aspects of PSII function

    • In LPE1-deficient plants, reduced PSII activity was observed through this method

  • Protein labeling and turnover assessment:

    • In vivo protein labeling can reveal D1 synthesis rates

    • Pulse-chase experiments with radioactive methionine can track D1 protein turnover

    • This approach demonstrated drastically reduced D1 levels in LPE1 mutants

  • Blue native gel electrophoresis:

    • This technique separates intact protein complexes

    • It can reveal whether the recombinant psbA1 protein assembles properly into PSII complexes

    • Co-migration with PSII monomer and PSII supercomplexes indicates functional integration

  • Oxygen evolution measurements:

    • Direct measurement of PSII function through oxygen electrode techniques

    • Quantifies the water-splitting activity of PSII complexes

  • High-light stress response:

    • Exposing samples to high light intensity and measuring photosynthetic parameters

    • This tests the system's capability for PSII repair, a process heavily dependent on D1 synthesis

    • High light exposure aggravated D1 accumulation defects in LPE1 mutants

  • Polysome association analysis:

    • Assesses whether the recombinant protein supports efficient translation of psbA mRNA

    • Can reveal defects in ribosomal loading that would impact D1 synthesis

These complementary approaches provide a comprehensive assessment of recombinant psbA1 protein functionality in both isolation and integrated systems.

What are the experimental approaches to study light-dependent regulation of psbA1 translation?

Investigating the light-dependent regulation of psbA1 translation requires specialized experimental approaches that capture the dynamic relationship between light exposure and protein synthesis:

  • Light/dark transition experiments:

    • Comparison of psbA mRNA translation in plants or cell cultures exposed to different light regimes

    • Light exposure durations ranging from 6-48 hours have demonstrated progressive effects on D1 synthesis

    • Analysis can involve protein quantification through western blotting or in vivo labeling

  • RNA Immunoprecipitation (RIP) under varying light conditions:

    • This approach revealed that LPE1 associated with greater amounts of psbA mRNA following light exposure

    • Samples exposed to light for varying durations (8, 24, or 48 hours) showed progressively increasing association between LPE1 and psbA mRNA

  • Redox manipulation experiments:

    • Application of reducing agents (DTT) or oxidizing agents (DTNB) to simulate or counteract light effects

    • In vivo RIP analysis showed that DTT treatment increased the association of LPE1 with psbA mRNA, while DTNB decreased it

    • These manipulations can be performed in both light and dark conditions to distinguish direct redox effects from light-dependent processes

  • Redox state assessment of regulatory proteins:

    • Nonreducing SDS/PAGE with 4-acetoamido-4-maleimidylstilbene-2,2-disulfonic acid (AMS) binding

    • This technique distinguishes between oxidized and reduced forms of proteins (e.g., LPE1)

    • Tracking the reduced form of regulatory proteins following light exposure provides mechanistic insights

  • Polysome profiling across light/dark transitions:

    • Measures the association of ribosomes with psbA mRNA under different light conditions

    • Quantifies the efficiency of translation initiation as a function of light exposure

These methodologies collectively provide a comprehensive toolkit for dissecting the complex interplay between light, redox state, and psbA1 translation regulation.

How can site-directed mutagenesis be used to study critical functional domains in psbA1 protein?

Site-directed mutagenesis offers a powerful approach to dissect the structure-function relationships in psbA1 protein by selectively modifying specific amino acid residues:

  • Target selection strategies:

    • Conserved residues identified through sequence alignment across species

    • Residues implicated in cofactor binding (chlorophylls, carotenoids, manganese cluster)

    • Putative interaction sites with other PSII subunits

    • Redox-active cysteine residues that might participate in redox regulation

    • D1 protein has several functionally critical regions including the QB binding pocket and regions involved in the oxygen-evolving complex

  • Mutagenesis approaches:

    • QuikChange or overlap extension PCR for site-directed mutagenesis of recombinant psbA1

    • CRISPR/Cas9 genome editing for in vivo modification of the chloroplast genome

    • For studying the LPE1-psbA mRNA interaction, mutations in the 5' UTR of psbA mRNA can identify critical binding sequences

  • Functional assessment of mutants:

    • Comparison of wild-type and mutant proteins for:

      • RNA binding capacity (if studying regulatory interactions)

      • Protein-protein interactions with other PSII components

      • Assembly into PSII complexes

      • Photosynthetic electron transport efficiency

      • Susceptibility to photodamage

      • Response to redox regulation

  • Mutations targeting redox regulation:

    • Based on the finding that LPE1 association with psbA mRNA is redox-dependent , mutation of cysteine residues in regulatory proteins can identify those involved in redox sensing

    • Substitution of cysteine with serine (similar size but not redox-active) or alanine (removal of thiol group) can eliminate redox sensitivity

  • Structure-guided mutagenesis:

    • Using available structural data to inform mutation design

    • Creating rational mutations based on predictive models of protein-RNA or protein-protein interfaces

This systematic mutagenesis approach can elucidate the molecular mechanisms underlying psbA1 function and regulation, particularly with respect to its roles in PSII assembly, photosynthetic electron transport, and response to varying light conditions.

What are the latest advanced techniques for studying the dynamics of psbA1 protein in PSII assembly and repair?

Advanced techniques for studying psbA1 protein dynamics in PSII assembly and repair provide unprecedented temporal and spatial resolution:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of PSII assembly intermediates at near-atomic resolution

    • Can capture different states of D1 protein integration into the PSII complex

    • Particularly valuable for understanding how newly synthesized D1 protein replaces damaged protein during PSII repair

  • Single-molecule fluorescence techniques:

    • Allows tracking of individual D1 protein molecules in thylakoid membranes

    • Fluorescence Recovery After Photobleaching (FRAP) can measure D1 protein mobility

    • Single-molecule FRET (Förster Resonance Energy Transfer) can detect conformational changes during assembly

  • Time-resolved mass spectrometry:

    • Quantifies protein dynamics at different stages of PSII assembly and repair

    • Pulse-SILAC (Stable Isotope Labeling with Amino acids in Cell culture) approaches can differentiate newly synthesized from existing D1 protein

    • Crosslinking mass spectrometry can identify transient interaction partners during assembly

  • Super-resolution microscopy:

    • Techniques like PALM (Photoactivated Localization Microscopy) or STORM (Stochastic Optical Reconstruction Microscopy) surpass the diffraction limit

    • Enable visualization of D1 protein distribution within thylakoid membranes at nanometer resolution

    • Can track clustering and organization of PSII complexes

  • In vivo chloroplast transformation systems:

    • Allow introduction of tagged versions of psbA1 into the chloroplast genome

    • Enable real-time tracking of D1 protein in its native environment

    • Can be combined with inducible promoters to control expression timing

  • Proximity-dependent labeling techniques:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to D1 during assembly

    • Help map the changing interaction landscape during PSII biogenesis and repair

These cutting-edge approaches complement traditional biochemical methods and provide dynamic information about D1 protein in the context of PSII assembly and repair processes.

How can computational modeling predict the impact of mutations in psbA1 protein?

Computational modeling offers powerful predictive capabilities for understanding how mutations affect psbA1 protein structure, function, and interactions:

These computational approaches provide a rational framework for designing mutation studies and interpreting experimental results, accelerating the discovery process and reducing the need for exhaustive experimental testing.

What are the current challenges and future directions in psbA1 protein research?

Current challenges and future directions in psbA1 protein research span multiple levels of biological organization and technological development:

  • Mechanistic understanding of light-regulated translation:

    • While the involvement of regulatory proteins like LPE1 and HCF173 in psbA mRNA translation has been established , the complete mechanistic pathway linking light perception to translation remains incompletely understood

    • Future research should focus on identifying additional components in this regulatory network and elucidating the precise sequence of molecular events

  • Species-specific regulatory mechanisms:

    • Current research indicates divergent regulatory mechanisms between higher plants and primitive photosynthetic organisms

    • Future comparative studies across evolutionary diverse photosynthetic organisms could reveal both conserved core mechanisms and lineage-specific adaptations

  • Redox regulation at the molecular level:

    • The redox-dependent binding of LPE1 to psbA mRNA has been demonstrated , but the structural basis for this regulation remains unclear

    • Identifying specific cysteine residues involved and characterizing their three-dimensional configuration in oxidized versus reduced states represents an important research direction

  • Integration with environmental responses:

    • Understanding how psbA1 regulation interfaces with broader stress responses beyond light variation

    • Exploring how temperature, drought, and other environmental factors modify D1 synthesis and PSII repair

  • Technical challenges in recombinant production:

    • Despite advances in expression systems , producing fully functional recombinant D1 protein that integrates properly into PSII remains challenging

    • Development of improved membrane protein expression systems specifically optimized for photosynthetic proteins represents an important technical frontier

  • Synthetic biology applications:

    • Engineering modified D1 proteins with enhanced stability or altered spectral properties

    • Developing synthetic regulatory circuits to control D1 synthesis in response to novel signals

    • Creating minimal PSII systems with reduced complexity for biotechnological applications

  • Translating fundamental knowledge to crop improvement:

    • Applying insights from D1 protein dynamics to enhance photosynthetic efficiency in crops

    • Engineering more robust PSII repair mechanisms to improve plant performance under fluctuating light conditions

These research directions collectively aim to deepen our understanding of this critical component of photosynthesis while leveraging this knowledge for applications in agriculture, renewable energy, and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.