Recombinant Phyllostomus hastatus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Phyllostomus hastatus (Greater spear-nosed bat)
Target Names
Target Protein Sequence
MALPFQLGFQDATSPIMEELLHFHDHTLMIVFMISSLVLYLISSMLTTRLTHTSTMDAQE VETIWTILPAIILITIALPSLRILYMMDEINNPSMTIKTMGHQWYWSYEYTDYSELCFDS YMIPTSDLKSGGLRLLEVDNRVVIPMEMTVRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLLSTRPGLYYGQCSEICGSNHSFMPIVLEMVTLNCFEKWSTSML
Uniprot No.

Target Background

Function

Recombinant Phyllostomus hastatus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme complex drives oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site (subunit 1). This binuclear center (BNC) consists of heme A3 and CuB, reducing molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Phyllostomus hastatus Cytochrome c oxidase subunit 2 (MT-CO2)?

Recombinant Phyllostomus hastatus Cytochrome c oxidase subunit 2 (MT-CO2) is a laboratory-produced version of the naturally occurring MT-CO2 protein found in the Greater spear-nosed bat (Phyllostomus hastatus). Cytochrome c oxidase, also known as Complex IV, serves as the terminal enzyme in the electron transport chain of cellular respiration, playing a crucial role in energy production by transferring electrons from cytochrome c to molecular oxygen. The protein consists of 227 amino acids and contains transmembrane segments critical for its function in the inner mitochondrial membrane.

MT-CO2 is encoded by the mitochondrial genome in natural settings but can be expressed in heterologous systems such as E. coli for research purposes. The protein is also known by several synonyms including COII, COX2, COXII, and MTCO2. In its recombinant form, it typically includes a purification tag (such as a His-tag) to facilitate isolation and detection in experimental settings.

The recombinant protein is produced through bacterial expression systems, with the coding sequence optimized for the host organism. According to available product information, recombinant P. hastatus MT-CO2 is typically expressed in E. coli with an N-terminal His-tag to facilitate purification .

How is Recombinant Phyllostomus hastatus MT-CO2 typically expressed and purified?

The expression and purification of Recombinant Phyllostomus hastatus MT-CO2 involves several optimized steps to ensure high yield and purity of this membrane-associated protein. The standard methodology follows this general workflow:

First, the coding sequence for P. hastatus MT-CO2 is optimized for the expression host (typically E. coli) and cloned into an appropriate expression vector containing a strong promoter (usually T7 or similar) and an affinity tag sequence (commonly a His-tag at the N-terminus). The construct is then transformed into an E. coli strain optimized for recombinant protein expression, such as BL21(DE3) .

For expression, bacterial cultures are grown to mid-log phase (OD600 of 0.6-0.8) before induction with IPTG or another suitable inducer. Due to the membrane-associated nature of MT-CO2, expression conditions are often modified to enhance protein solubility, including lower induction temperatures (16-20°C) and extended expression periods.

After expression, cells are harvested by centrifugation and lysed to release the recombinant protein. Purification typically employs immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag to capture the protein of interest . This may be followed by additional purification steps such as ion exchange chromatography or size exclusion chromatography to achieve higher purity.

The purified protein undergoes quality control analysis by SDS-PAGE and Western blotting to confirm identity and purity. The final preparation is typically prepared as a lyophilized powder for long-term stability or stored in a buffer containing glycerol as a cryoprotectant to prevent freeze-thaw damage.

What are the storage conditions for Recombinant Phyllostomus hastatus MT-CO2?

Proper storage of Recombinant Phyllostomus hastatus MT-CO2 is critical for maintaining structural integrity and biological activity. Based on product specifications and standard practices for similar proteins, the following storage recommendations should be followed:

For long-term storage, the protein should be kept at -20°C or preferably -80°C . The lyophilized powder form offers the greatest stability for extended periods. If stored in solution, a Tris-based buffer (pH 8.0) with 50% glycerol is recommended as a cryoprotectant . The presence of trehalose (6%) in the storage buffer may also enhance stability by preventing protein aggregation during freeze-thaw cycles.

When reconstituting lyophilized protein, the vial should be briefly centrifuged before opening to bring contents to the bottom. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, followed by the addition of glycerol (5-50% final concentration) for long-term storage . The solution should be divided into small aliquots to prevent repeated freeze-thaw cycles.

Protein stability can be monitored over time by SDS-PAGE analysis and functional assays to ensure the protein retains its structural and functional integrity throughout the storage period.

What are the common applications of Recombinant Phyllostomus hastatus MT-CO2 in research?

Recombinant Phyllostomus hastatus MT-CO2 serves as a valuable tool in multiple research areas, offering insights into both basic and applied biological questions. The primary applications include:

In structural biology studies, the purified protein can be used for crystal structure determination, enabling researchers to understand protein folding, membrane insertion mechanisms, and inter-subunit interactions within the cytochrome c oxidase complex. Comparative structural analysis with homologous proteins from other species provides insights into evolutionary adaptations of mitochondrial respiratory proteins.

For evolutionary and phylogenetic research, MT-CO2 serves as an important molecular marker due to its mitochondrial origin and moderate evolutionary rate. Sequence analysis of this protein across bat species contributes to understanding bat evolution, speciation patterns, and adaptation to various ecological niches. The MT-CO2 gene has been used in constructing phylogenetic trees of bat species, helping clarify taxonomic relationships within Chiroptera.

In immunological applications, the recombinant protein can be used to generate specific antibodies for detection of MT-CO2 in tissue samples and development of immunoassays. These tools are valuable for studying mitochondrial function in normal and pathological states. Additionally, serological studies have shown that phyllostomid bats, including Phyllostomus hastatus, can harbor antibodies against hantaviruses, making this protein potentially relevant for host-pathogen interaction studies .

The protein also serves as a valuable tool for functional studies of the respiratory chain, investigation of mutations affecting protein function, and comparative studies of mitochondrial bioenergetics across species. These applications extend our understanding of cellular respiration and metabolic adaptations in different organisms.

How does the structure of Phyllostomus hastatus MT-CO2 compare to homologous proteins in other species?

Comparative analysis of Phyllostomus hastatus MT-CO2 with homologous proteins from other species reveals important evolutionary patterns and functional constraints. While specific structural data for P. hastatus MT-CO2 is somewhat limited, meaningful comparisons can be made based on sequence conservation and known structures from related organisms.

When comparing P. hastatus MT-CO2 with homologous proteins from other bat species, sequence identity typically ranges from 85-95%, with most variations occurring in regions that do not directly impact protein function. These differences likely reflect evolutionary adaptation to different ecological niches and metabolic requirements. For instance, bat species with high metabolic demands due to flight capabilities may show specific adaptations in their respiratory proteins.

Comparing bat MT-CO2 with that of other mammals reveals more pronounced differences, with sequence identity dropping to 75-85%. These differences are concentrated in variable loops and surface regions, while the core functional domains, particularly the copper-binding sites critical for electron transfer, remain highly conserved. This pattern of conservation reflects strong functional constraints on regions directly involved in the catalytic mechanism.

The structure-function relationship in MT-CO2 is further illuminated by studies on the W56R mutation in yeast cytochrome c oxidase. This mutation, occurring in a transmembrane region, significantly affects protein function by altering membrane insertion and stability . Similar positions in P. hastatus MT-CO2 may be equally important for proper protein folding and function, highlighting the critical nature of transmembrane domain integrity.

What experimental challenges are associated with working with Recombinant Phyllostomus hastatus MT-CO2?

Working with Recombinant Phyllostomus hastatus MT-CO2 presents several technical challenges that researchers must address to achieve successful experimental outcomes. These challenges stem primarily from the protein's membrane-associated nature and complex structural requirements.

Expression and solubility issues represent a major hurdle. As a membrane protein with multiple transmembrane domains, MT-CO2 often forms inclusion bodies when expressed in bacterial systems, resulting in poor yields of properly folded protein. Strategies to overcome this include lowering induction temperature, using specialized E. coli strains designed for membrane protein expression, incorporating solubility-enhancing tags, or employing fusion partners that improve folding and solubility.

Purification presents another set of challenges. The hydrophobic nature of MT-CO2 necessitates the use of detergents for extraction from membranes and maintenance of solubility during purification. Selecting appropriate detergents that extract the protein efficiently without causing denaturation is critical. Common choices include mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or zwitterionic detergents like CHAPS. Furthermore, purification yields are typically lower than for soluble proteins, and multiple chromatography steps may be needed to achieve high purity.

Stability considerations are equally important. MT-CO2 may exhibit limited stability in solution, with a tendency toward aggregation during concentration steps. Buffer optimization becomes essential, with additions such as glycerol, specific lipids, or mild detergents often necessary to maintain native-like structure. The lyophilized form, as supplied by some manufacturers, provides better stability for long-term storage .

Functional assessment presents unique challenges since MT-CO2 is typically part of a larger cytochrome c oxidase complex. Evaluating the activity of the isolated subunit requires specialized approaches, potentially including reconstitution into proteoliposomes or assembly with other subunits of the complex. Spectroscopic methods for functional analysis require careful baseline correction and appropriate control experiments.

Finally, species-specific antibody cross-reactivity can be problematic. Antibodies raised against MT-CO2 from other species may show limited recognition of the P. hastatus protein due to sequence variations in immunogenic epitopes. Validation of antibodies with the purified recombinant protein is essential before use in experimental applications.

How can MT-CO2 be used for evolutionary and phylogenetic studies of bat species?

MT-CO2 serves as a valuable molecular marker for evolutionary and phylogenetic studies of bat species due to its mitochondrial origin, moderate evolutionary rate, and functional importance. The application of this protein in evolutionary studies involves several methodological approaches that provide insights into bat evolution, speciation, and adaptation.

Sequence-based phylogenetic analysis represents the most direct application. MT-CO2 sequences from different bat species can be aligned and used to construct phylogenetic trees using maximum likelihood, Bayesian inference, or distance-based methods. These analyses reveal evolutionary relationships between bat species and families, helping to resolve taxonomic uncertainties. The methodology typically involves sequence alignment using tools like MUSCLE or CLUSTAL, model selection for nucleotide or amino acid substitution, and tree construction with statistical support values.

Selection pressure analysis using the ratio of non-synonymous to synonymous substitutions (dN/dS) can identify regions of the protein under purifying selection (conserved functional domains) versus those experiencing positive selection (potentially adaptive changes). This approach has revealed that functional domains of MT-CO2, particularly those involved in electron transfer, experience strong purifying selection across bat lineages, while other regions may show lineage-specific adaptations.

Comparative genomic analysis of MT-CO2 across bat species with different ecological niches and metabolic demands can identify convergent adaptations or lineage-specific changes that correlate with ecological factors. For example, comparing MT-CO2 sequences between insectivorous, frugivorous, and sanguivorous bats may reveal adaptations related to different energy requirements. Phyllostomus hastatus, being an omnivorous bat, may show intermediate or unique adaptations in its MT-CO2 sequence .

The protein can also be used for population genetics applications, including estimation of genetic diversity within species, detection of population structure, and inference of demographic history. Analysis of MT-CO2 sequence variation within P. hastatus populations can reveal patterns of gene flow, population bottlenecks, or expansions that inform conservation strategies for this species.

Finally, molecular dating approaches using MT-CO2 as a molecular clock (calibrated with fossil records) can estimate divergence times between bat lineages, allowing researchers to correlate speciation events with geological or climatic changes throughout evolutionary history.

What techniques are most effective for assessing the functional activity of Recombinant Phyllostomus hastatus MT-CO2?

Assessing the functional activity of Recombinant Phyllostomus hastatus MT-CO2 requires specialized techniques that address the challenges of working with an isolated subunit of a multi-protein complex. Several methodological approaches have proven effective for comprehensive functional characterization.

Reconstitution systems represent a primary approach for functional studies. Since MT-CO2 normally functions as part of the larger cytochrome c oxidase complex, reconstitution with other subunits provides the most physiologically relevant context for activity assessment. This can be achieved through co-expression of multiple subunits in heterologous systems or in vitro assembly of purified subunits in the presence of appropriate lipids. Incorporation into nanodiscs or liposomes provides a membrane environment that supports proper protein folding and function. The reconstitution protocol typically involves optimizing lipid composition, removing detergents using biobeads or dialysis, and verifying complex formation using techniques such as blue native PAGE or size exclusion chromatography.

Electron transfer activity assays provide direct measurement of functional capacity. Spectrophotometric monitoring of cytochrome c oxidation (measuring decrease in absorbance at 550 nm) offers a quantitative assessment of electron transfer activity. Oxygen consumption measurements using oxygen electrodes provide complementary data on the rate of the complete reaction. These assays should be conducted under controlled conditions with optimal temperature (typically 25-37°C), physiological pH (7.0-7.4), and appropriate cofactors including copper and heme.

Binding assays assess interaction with partner proteins and substrates. Surface plasmon resonance (SPR) can measure binding kinetics between MT-CO2 and other subunits of the cytochrome c oxidase complex or with cytochrome c. Alternative techniques include microscale thermophoresis (MST) for solution-based interaction studies or isothermal titration calorimetry (ITC) for thermodynamic parameters of binding. These approaches require careful consideration of membrane protein immobilization strategies and detergent compatibility.

Structural integrity assessment using biophysical techniques provides indirect evidence of functional potential. Circular dichroism (CD) spectroscopy can verify proper secondary structure formation, while intrinsic fluorescence spectroscopy monitors tertiary structure. Comparison with native or wild-type proteins provides a reference point for assessing structural integrity. These approaches are particularly valuable when combined with functional assays to correlate structure with activity.

Metal binding analysis is crucial given the importance of copper centers in MT-CO2 function. Atomic absorption spectroscopy can quantify metal content, while electron paramagnetic resonance (EPR) spectroscopy characterizes the electronic environment of copper centers. Metal titration experiments determine binding affinity and stoichiometry. These analyses require metal-free buffer preparation and appropriate controls for non-specific binding.

What is the relationship between MT-CO2 and hantavirus in Phyllostomus hastatus?

The relationship between MT-CO2 and hantavirus in Phyllostomus hastatus represents an emerging area of research at the intersection of virology, immunology, and mitochondrial biology. While direct mechanistic connections between MT-CO2 and hantavirus infection remain to be fully elucidated, several important observations and potential relationships deserve consideration.

The connection between MT-CO2 and viral infection may be indirect, mediated through mitochondrial involvement in antiviral responses. Mitochondria serve as critical platforms for innate immune signaling, particularly through the mitochondrial antiviral signaling protein (MAVS) pathway, which activates interferon responses. As a component of the mitochondrial respiratory chain, MT-CO2 could potentially influence mitochondrial function during viral infection, affecting energy production and cellular stress responses.

Viral infections often modulate host cell metabolism to facilitate viral replication. Hantaviruses may influence mitochondrial function as part of their replication strategy, potentially altering respiratory chain components including cytochrome c oxidase. Changes in MT-CO2 expression, post-translational modifications, or activity could be part of the cellular response to viral infection or direct viral interference with host metabolic processes.

Bats are unique among mammals in their ability to serve as reservoirs for numerous viruses without developing severe disease. This viral tolerance may be partly attributed to distinctive features of bat mitochondrial function and metabolism. Phyllostomus hastatus MT-CO2 might possess unique structural or functional characteristics that contribute to the species' ability to harbor viruses without pathological consequences. Comparative studies of MT-CO2 from different bat species with varying viral susceptibilities could provide insights into these potential adaptations.

Research methodologies to explore the MT-CO2-hantavirus relationship could include co-immunoprecipitation studies to identify potential interactions between viral proteins and mitochondrial components, analysis of MT-CO2 expression and cytochrome c oxidase activity during viral infection, and assessment of mitochondrial function in infected versus uninfected bat cells. Such studies could illuminate the complex interplay between viral infection, mitochondrial function, and host immune responses in this important viral reservoir species.

How can Recombinant Phyllostomus hastatus MT-CO2 be used in immunological studies?

Recombinant Phyllostomus hastatus MT-CO2 offers valuable opportunities for immunological investigations, ranging from antibody production to complex studies of host-pathogen interactions. Several methodological approaches demonstrate how this protein can be effectively utilized in immunological research.

For antibody production and characterization, the recombinant protein serves as an ideal immunogen. Polyclonal antibodies can be generated through a standard immunization protocol involving primary immunization with 50-100 μg recombinant MT-CO2 in complete Freund's adjuvant, followed by booster immunizations with the protein in incomplete Freund's adjuvant. The resulting antibodies can be purified by protein A/G affinity chromatography or antigen-specific affinity purification using immobilized MT-CO2. Validation through ELISA, Western blot, and immunoprecipitation confirms specificity and sensitivity.

Monoclonal antibodies can be developed through hybridoma technology, involving mouse immunization with the recombinant protein, fusion of splenocytes with myeloma cells, and screening of hybridoma supernatants. Alternative approaches include phage display antibody library screening or single B-cell sorting and antibody cloning. Epitope mapping using peptide arrays or hydrogen-deuterium exchange mass spectrometry characterizes the binding sites recognized by these antibodies.

The recombinant protein enables development of various immunoassay systems. Direct ELISA can detect antibodies in bat sera, potentially identifying serological evidence of exposure to pathogens, as has been demonstrated with hantavirus antibodies in Phyllostomus hastatus . Sandwich ELISA allows quantification of MT-CO2 in tissue samples, while competitive ELISA can detect conformational changes in the protein. Optimization parameters include coating concentration, blocking agents, detection antibody conditions, and substrate selection.

For immunohistochemistry applications, anti-MT-CO2 antibodies can localize the protein in tissue sections following appropriate fixation and antigen retrieval. Detection systems may include biotinylated secondary antibodies with streptavidin-HRP or polymer-based detection systems. These techniques require careful validation through isotype controls, absorption controls with recombinant protein, and comparison with known expression patterns.

In comparative immunology studies, anti-P. hastatus MT-CO2 antibodies can be tested for cross-reactivity against MT-CO2 from other bat species, non-bat mammals, or human MT-CO2. This approach provides insights into epitope conservation across species and potential utility in broader research applications. Evolutionary immunology investigations may include T-cell epitope prediction, MHC binding assays, and comparative analysis with other species to identify conserved versus variable epitopes.

For host-pathogen interaction studies, MT-CO2 expression and modification can be monitored during viral infection using techniques such as qPCR, Western blot, and immunofluorescence microscopy. These approaches can reveal changes in mitochondrial protein expression or localization that may occur during infection with viruses like hantavirus that have been detected serologically in P. hastatus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.