Recombinant Phyllotis darwini NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant Phyllotis darwini MT-ND3 is predominantly expressed in Escherichia coli (E. coli) expression systems . This bacterial expression platform offers several advantages for producing this mitochondrial protein, including high yields, cost-effectiveness, and well-established protocols. The in vitro E. coli expression system allows for the production of this transmembrane protein in quantities sufficient for various research applications .

Enzymatic Activity

The MT-ND3 protein serves as a core subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which catalyzes the first step in the electron transport chain of oxidative phosphorylation . This complex facilitates the transfer of electrons from NADH to ubiquinone (coenzyme Q), coupled with proton translocation across the inner mitochondrial membrane . The process generates a proton gradient that drives ATP synthesis, making it fundamental to cellular energy production.

While MT-ND3 itself does not possess independent enzymatic activity, it is essential for the proper functioning of Complex I, which exhibits NADH dehydrogenase (ubiquinone) activity with the EC classification 1.6.5.3 . The protein contributes to both the structural integrity and catalytic function of this large multi-subunit complex.

Role in Respiratory Chain

As a component of Complex I, MT-ND3 participates in the respiratory electron transport chain, which is crucial for ATP synthesis through chemiosmotic coupling . Complex I represents the largest complex in the respiratory chain, comprising multiple subunits that collectively enable electron transfer and proton pumping across the mitochondrial membrane. The positioning of MT-ND3 within this complex is strategic for its functional contribution to the electron transport mechanism.

Disease Associations

While the recombinant Phyllotis darwini MT-ND3 is primarily used for research purposes, the human homolog of this protein has significant clinical implications. Mutations in the human MT-ND3 gene have been associated with several mitochondrial disorders, including:

  1. Mitochondrial Complex I Deficiency, Mitochondrial Type 1

  2. Leigh Syndrome

  3. Leber hereditary optic neuropathy

  4. Potential involvement in Parkinson's disease

A particularly notable mutation is the T10158C transition in human MT-ND3, which changes a conserved serine residue to proline at codon 34 . This mutation has been documented in a case of Leigh syndrome with early lethality, characterized by severe complex I deficiency and progressive neurological deterioration .

Pathogenic Mechanisms

The pathogenicity of MT-ND3 mutations stems from their impact on Complex I function, which can disrupt electron transport and ATP production. Research has shown that these mutations can exist in heteroplasmic conditions (variable proportions of mutant mtDNA in different tissues), which is a common feature of pathogenic mitochondrial DNA mutations . The tissue specificity of these mutations contributes to the diverse clinical presentations of mitochondrial disorders.

The study of recombinant MT-ND3 from various species, including Phyllotis darwini, provides valuable comparative data for understanding the functional consequences of mutations in this highly conserved protein. Such research may contribute to the development of diagnostic tools and potential therapeutic strategies for mitochondrial disorders.

Research Applications

Recombinant Phyllotis darwini MT-ND3 serves multiple research purposes in the study of mitochondrial function and related disorders:

Functional Assays

The protein can be used in various biochemical assays to investigate:

  • Complex I assembly and function

  • Electron transport efficiency

  • Interaction with other mitochondrial proteins

  • Effects of potential inhibitors or activators

Antibody Production

Recombinant MT-ND3 serves as an immunogen for the production of antibodies against this protein, which can be utilized in techniques such as Western blotting, immunohistochemistry, and immunoprecipitation for detecting and studying the native protein in biological samples .

Comparative Studies

The recombinant protein enables comparative analyses across species to identify conserved functional domains and species-specific variations that might influence respiratory chain efficiency or susceptibility to dysfunction.

Sequence Conservation and Evolutionary Significance

The MT-ND3 protein exhibits remarkable conservation across species, reflecting its fundamental role in mitochondrial function. The conservation of amino acid sequence is particularly high in functionally critical regions, such as those involved in interaction with other Complex I subunits or participation in electron transport.

The serine residue at position 34 (in human MT-ND3), which is affected by the pathogenic T10158C mutation, is located in a highly evolutionary conserved region . This conservation underscores the functional importance of this residue and explains the severe phenotypic consequences of its mutation.

Comparative studies between human MT-ND3 and its homologs in other species, including Phyllotis darwini, provide insights into the evolutionary adaptation of the respiratory chain to different metabolic demands and environmental conditions.

Future Research Directions

The study of recombinant Phyllotis darwini MT-ND3 and its homologs in other species presents several promising avenues for future research:

  1. Development of high-resolution structural models of Complex I, incorporating detailed information about MT-ND3's position and interactions

  2. Investigation of species-specific variations in MT-ND3 that might confer differential efficiency or robustness of the respiratory chain

  3. Exploration of potential therapeutic approaches targeting Complex I function in mitochondrial disorders

  4. Utilization of recombinant MT-ND3 in drug screening assays to identify compounds that might modulate Complex I activity

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is required, please inform us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Phyllotis darwini (Darwin's leaf-eared mouse)
Target Names
Target Protein Sequence
MNMIMAMLANISISSCLIIIAFWLPHLNIYTEKASPYECGFDPMSSARLPFSMKFFLVGI TFLLFDLEIALLLPLPWALHSTNMFLTTLTSFILVSVLALGLAYEWMNKGLEWTE
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor. It is essential for the catalytic activity of Complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of MT-ND3 in the respiratory chain?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is one of seven mitochondrially-encoded subunits of Complex I, the largest complex in the respiratory chain. This protein is integrated into the membrane domain of Complex I, which consists of at least 45 subunits in mammals. MT-ND3 plays a critical role in the electron transfer pathway, participating in the coupling of NADH oxidation to ubiquinone reduction while facilitating proton translocation across the inner mitochondrial membrane. This process contributes to the electrochemical gradient used for ATP synthesis .

The ND3 subunit contains highly conserved hydrophobic domains that are essential for maintaining the structural integrity of Complex I. Specific residues in ND3, such as alanine at position 47 in humans, are crucial for proper complex function. In Phyllotis darwini, as in other mammals, MT-ND3 likely occupies a strategic position at the interface between the peripheral arm and the membrane domain of Complex I .

How does Phyllotis darwini MT-ND3 differ from other mammalian MT-ND3 proteins?

While the search results don't specifically address sequence variations in Phyllotis darwini MT-ND3, mitochondrial proteins typically show evolutionary conservation in functional domains with species-specific variations in less critical regions. The hydrophobic core domains of ND3 are likely highly conserved across mammals, including Phyllotis darwini, due to their essential role in Complex I assembly and function.

Comparative analysis would typically reveal that Phyllotis darwini MT-ND3 shares approximately 80-95% sequence identity with other rodent species, with most differences occurring in third codon positions that don't alter amino acid sequences. Key functional residues, particularly those implicated in human pathologies like the A47 position, would likely be conserved in Phyllotis darwini MT-ND3 .

What is the typical expression level of MT-ND3 in Phyllotis darwini tissues?

MT-ND3 expression varies considerably across different tissues based on their metabolic requirements. In mammals generally, brain, heart, liver, and skeletal muscle typically show the highest expression levels of Complex I components due to their high energy demands.

Based on studies of complex I in other mammalian systems, we can estimate that MT-ND3 in Phyllotis darwini would follow similar tissue-specific patterns. In mouse tissues, Complex I content can vary up to 10-fold between different tissues, with brain mitochondria containing approximately 19 pmol/mg of protein. Using fluorescence-based quantification methods, approximately 90,000 Complex I molecules have been detected in a single human cell, which would include corresponding numbers of MT-ND3 subunits .

What are the most effective methods for recombinant expression of Phyllotis darwini MT-ND3?

Recombinant expression of mitochondrially-encoded proteins presents unique challenges due to their hydrophobic nature and the specialized mitochondrial genetic code. For Phyllotis darwini MT-ND3, researchers should consider the following optimized approach:

  • Gene Synthesis and Codon Optimization: The MT-ND3 sequence should be codon-optimized for the selected expression system, with consideration of the differences between mitochondrial and nuclear genetic codes.

  • Expression Vector Selection: For mitochondrial delivery, design a construct with appropriate promoters. As demonstrated in therapeutic approaches for ND3, pT7-based vectors can be used for in vitro transcription systems to prepare therapeutic mRNA .

  • Delivery System: Consider mitochondria-targeted delivery systems such as MITO-Porters or other mitochondrial transfection reagents for introducing recombinant MT-ND3 into cells. These approaches have been successfully used in delivering ND3 mRNA to mitochondria in diseased cells .

  • Verification: Employ methods such as ARMS-PCR for verification of successful expression and incorporation into Complex I. This technique has been effectively used to quantify mutation rates in ND3 and could be adapted to confirm recombinant expression .

How can researchers accurately measure the activity of recombinant MT-ND3 in Complex I?

Measuring the activity of recombinant MT-ND3 requires assessment of its incorporation and functionality within Complex I. The following methodological approach is recommended:

  • Native PAGE with In-gel Activity Assay: Separate mitochondrial complexes using blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by in-gel activity staining to visualize NADH dehydrogenase activity. This approach allows evaluation of whether recombinant MT-ND3 has been properly integrated into functional Complex I .

  • Spectrophotometric Analysis: Measure NADH:ubiquinone oxidoreductase activity by monitoring the decrease in NADH absorbance at 340 nm. The typical catalytic turnover rate for Complex I is approximately 10,000 min^-1 for NADH:ubiquinone reductase activity in mouse brain mitochondrial preparations .

  • Oxygen Consumption Measurements: Use respirometry to assess the functional impact of recombinant MT-ND3 on mitochondrial respiration. This approach can detect whether the recombinant protein affects the coupling efficiency between electron transport and proton pumping.

  • FMN Fluorescence Quantification: Utilize flavin fluorescence scanning after native PAGE to quantify the absolute content of Complex I containing the recombinant MT-ND3. This technique has been shown to accurately determine Complex I content in various tissue preparations .

What approaches can be used to study the interaction between MT-ND3 and other Complex I subunits?

Investigating subunit interactions within Complex I requires specialized techniques due to the complex's large size and membrane-integrated nature:

  • Photoaffinity Labeling: This technique has been successfully employed to study inhibitor binding sites and subunit interactions in Complex I. For example, photoreactive derivatives of inhibitors like aurachin and korormicin have been used to identify interaction domains in Na+-NQR, another respiratory chain component .

  • Site-Directed Mutagenesis: Introduce specific mutations in MT-ND3 to evaluate their impact on Complex I assembly and function. Mutations of nucleophilic residues such as aspartate can provide insights into interaction domains, as demonstrated in studies of NqrB in Na+-NQR .

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify proximity relationships between MT-ND3 and neighboring subunits.

  • Cryo-EM Analysis: High-resolution structural studies can reveal the precise positioning of MT-ND3 within the Complex I structure and its interactions with adjacent subunits.

What are the known pathogenic mutations in Phyllotis darwini MT-ND3 and their functional impacts?

While specific pathogenic mutations in Phyllotis darwini MT-ND3 have not been documented in the provided search results, insights can be drawn from well-characterized human MT-ND3 mutations:

The 10197G>A mutation in human MT-ND3, which causes a change from a hydrophobic alanine to a hydrophilic threonine (A47T) in a highly conserved domain, has been associated with Leigh syndrome and dystonia. This mutation affects a residue that is likely conserved in Phyllotis darwini and other mammals, highlighting its functional importance .

The pathogenicity of such mutations is established through several criteria:

  • Association with clinical phenotypes across multiple unrelated families

  • Presence of heteroplasmy (variable percentages of mutant mtDNA in different tissues)

  • Higher percentage of mutant mtDNA in affected tissues

  • Biochemical evidence of isolated Complex I deficiency

  • Conservation of the affected amino acid across species

  • Transfer of the biochemical defect in cybrid cell experiments

Similar approaches could be used to identify and characterize pathogenic mutations in Phyllotis darwini MT-ND3.

How do mutations in MT-ND3 affect the electron transfer mechanism in Complex I?

Mutations in MT-ND3 can disrupt electron transfer through several mechanisms:

  • Structural Perturbations: Changes in amino acid properties (e.g., hydrophobic to hydrophilic as in the A47T mutation) can alter the protein's conformation, affecting the arrangement of redox centers in the electron transfer pathway .

  • Ubiquinone Binding Interference: Some MT-ND3 mutations may affect the binding of ubiquinone. Studies on Na+-NQR inhibitors suggest that perturbations in this region can interfere with ubiquinone reactions by:

    • Blocking structural rearrangements at cytoplasmic interfaces between subunits

    • Directly obstructing ubiquinone binding at interfacial areas

  • Proton Pumping Disruption: Alterations in MT-ND3 can uncouple electron transfer from proton translocation, reducing the efficiency of energy conservation.

  • Assembly Defects: Some mutations may impair the integration of MT-ND3 into Complex I, leading to decreased levels of fully assembled complex.

What methodologies can detect heteroplasmy levels in MT-ND3 mutations?

Accurate quantification of heteroplasmy (the proportion of mutant to wild-type mtDNA) is crucial for understanding the pathogenicity of MT-ND3 mutations. The following methods have proven effective:

  • ARMS-PCR (Amplification Refractory Mutation System): This technique has been successfully used for quantitative determination of mutation rates in MT-ND3. The approach involves:

    • Designing specific primers that discriminate between wild-type and mutant sequences

    • Developing standard curves by mixing known proportions of wild-type and mutant DNA

    • Performing quantitative PCR to determine the relative amounts of each variant

  • Next-Generation Sequencing: Deep sequencing approaches can provide highly accurate heteroplasmy measurements across the entire mitochondrial genome.

  • Digital Droplet PCR: This method offers absolute quantification of rare variants and is particularly useful for detecting low levels of heteroplasmy.

  • Pyrosequencing: A technique that provides accurate quantification of sequence variants at specific positions.

How can recombinant MT-ND3 be used in mitochondrial gene therapy approaches?

Recombinant MT-ND3 offers promising therapeutic potential for mitochondrial diseases involving ND3 mutations. Research indicates the following strategies:

  • mRNA Delivery to Mitochondria: Therapeutic wild-type MT-ND3 mRNA can be delivered to diseased cells using specialized delivery systems such as MITO-Porters. This approach has been investigated for treating cells with MT-ND3 mutations .

  • Vector Design Considerations: Effective therapeutic vectors should include:

    • A T7 promoter for efficient transcription

    • Wild-type MT-ND3 gene sequence

    • Appropriate mitochondrial targeting sequences

    • Elements for stability in the mitochondrial environment

  • Verification of Therapeutic Effect: The efficacy of gene therapy approaches can be evaluated by:

    • Measuring heteroplasmy levels using ARMS-PCR

    • Assessing mitochondrial respiration in treated cells

    • Monitoring changes in ATP synthesis and other functional parameters

What are the challenges in creating viable Phyllotis darwini MT-ND3 knockout models?

Creating MT-ND3 knockout models presents several specific challenges:

  • Mitochondrial Genome Manipulation: Unlike nuclear genes, mitochondrial genes are present in multiple copies per cell, making complete knockout technically challenging.

  • Heteroplasmy Management: Cells typically contain thousands of mtDNA copies, and a knockout approach would need to address the heteroplasmic state where both wild-type and modified mtDNA coexist.

  • Lethality Concerns: Complete loss of MT-ND3 function would likely be lethal, as it is essential for Complex I activity and cellular energy production.

  • Alternative Approaches:

    • RNA interference or antisense approaches to reduce expression

    • CRISPR-based approaches adapted for mitochondrial targeting

    • Cybrid cell models incorporating patient-derived mitochondria with MT-ND3 mutations

    • Bacterial models expressing recombinant Complex I components

How can researchers distinguish between primary effects of MT-ND3 manipulation and secondary metabolic adaptations?

Differentiating direct consequences of MT-ND3 manipulation from adaptive responses requires comprehensive experimental design:

  • Time-Course Analysis: Monitor changes immediately following MT-ND3 manipulation and at various time points to distinguish acute effects from adaptive responses.

  • Metabolic Flux Analysis: Trace the flow of metabolites through various pathways to identify shifts in metabolic routing that may represent compensatory mechanisms.

  • Transcriptomic and Proteomic Profiling: Analyze changes in gene expression and protein levels to identify regulatory adaptations triggered by MT-ND3 dysfunction.

  • Use of Inhibitors: Apply specific inhibitors of adaptive pathways to isolate the direct effects of MT-ND3 manipulation. For example, inhibitors like aurachin and korormicin can be used to block particular aspects of respiratory chain function .

  • In-gel Activity Assays: Use native PAGE followed by activity staining to directly assess Complex I function, as this approach can reveal immediate functional consequences of MT-ND3 manipulation .

How does Phyllotis darwini MT-ND3 compare with other rodent species in terms of sequence conservation and function?

Mitochondrial genes typically show varying degrees of conservation reflecting their functional constraints. For MT-ND3 in Phyllotis darwini:

  • Sequence Conservation: The most functionally critical regions of MT-ND3, particularly transmembrane domains and residues involved in ubiquinone interaction, would show high conservation across rodent species. For example, the alanine at position 47 (human numbering) is highly conserved across species due to its functional importance .

  • Functional Domains: Comparative analysis would likely reveal that functional domains of Phyllotis darwini MT-ND3 maintain similar structural properties to those in other rodents, despite potential variations in less critical regions.

  • Evolutionary Rate: MT-ND3, like other mitochondrial protein-coding genes, likely evolves more rapidly than nuclear-encoded Complex I subunits, but key functional residues would remain conserved.

  • Species-Specific Adaptations: Any unique features of Phyllotis darwini MT-ND3 might reflect adaptations to the species' ecological niche and metabolic requirements.

What insights can be gained from comparing mitochondrial and bacterial NADH-ubiquinone oxidoreductases?

Comparative analysis between mitochondrial Complex I and bacterial homologs provides evolutionary and functional insights:

  • Structural Similarities and Differences: Bacterial Complex I is generally smaller and more fragile than its mitochondrial counterpart. For example, separation of Escherichia coli membranes results in two Complex I flavin bands of approximately 550 and 170 kDa, with the smaller band corresponding to the NADH dehydrogenase module .

  • Functional Conservation: The core function of electron transfer from NADH to ubiquinone is conserved between bacterial and mitochondrial systems, though with variations in efficiency and regulation.

  • Inhibitor Sensitivity: Different sensitivities to inhibitors can reveal structural distinctions. For instance, studies on Na+-NQR from Vibrio cholerae demonstrate specific inhibitor binding patterns that may differ from those in mitochondrial Complex I .

  • Evolutionary Insights: The bacterial ancestors of mitochondria contained simpler versions of the respiratory complexes. Through endosymbiotic evolution, these complexes acquired additional subunits encoded by the nuclear genome, while maintaining core components like MT-ND3 in the mitochondrial genome.

How do plant and fungal NADH-ubiquinone oxidoreductases differ from mammalian systems containing MT-ND3?

Plant and fungal systems exhibit notable differences from mammalian NADH-ubiquinone oxidoreductases:

  • Multiple Dehydrogenases: Plants and fungi contain multiple NAD(P)H dehydrogenases in the inner mitochondrial membrane, all connected to the respiratory chain via ubiquinone, whereas mammals primarily rely on Complex I .

  • Structural Organization: Plant Complex I is slightly larger than the mammalian enzyme, likely due to the presence of extra subunits. This has been observed when comparing Complex I from Drosophila, earthworms, and plants using native gel electrophoresis .

  • Alternative Electron Entry Points: Plants and fungi possess additional, rotenone-insensitive NAD(P)H dehydrogenases on both the inner and outer surfaces of the inner mitochondrial membrane, providing alternative pathways for electron entry into the respiratory chain:

    • An external, Ca2+-dependent NAD(P)H dehydrogenase facing the intermembrane space

    • The standard proton-pumping Complex I (containing ND3) similar to mammals

    • An internal, rotenone-insensitive NAD(P)H dehydrogenase facing the matrix

  • Regulatory Mechanisms: The plant external NAD(P)H dehydrogenase is completely dependent on Ca2+ with a K0.5 of approximately 1 μM, representing a distinct regulatory mechanism not present in mammalian systems .

These differences reflect evolutionary adaptations to different metabolic requirements and environmental conditions across taxonomic groups.

What are the current challenges in structural studies of MT-ND3 within Complex I?

Structural studies of MT-ND3 face several technical challenges:

  • Membrane Protein Crystallization: As part of a large membrane protein complex, MT-ND3 is difficult to crystallize for traditional X-ray crystallography.

  • Size and Complexity: The large size of mammalian Complex I (approximately 1 MDa) complicates structural analysis of individual subunits like MT-ND3.

  • Dynamic Conformations: MT-ND3 likely undergoes conformational changes during the catalytic cycle, making it challenging to capture all functionally relevant states.

  • Integration with Cryo-EM: While cryo-electron microscopy has revolutionized structural studies of large complexes, resolving the detailed structure of smaller subunits like MT-ND3 within the larger Complex I remains challenging.

  • Heterologous Expression: Producing recombinant MT-ND3 for structural studies is complicated by its hydrophobicity and the need to incorporate it properly into the complex.

How can isotope labeling techniques be applied to study MT-ND3 dynamics?

Isotope labeling offers powerful approaches for investigating MT-ND3 dynamics:

  • Pulse-Chase Experiments: Using isotopically labeled amino acids during protein synthesis allows tracking of MT-ND3 assembly into Complex I and its turnover rate.

  • Hydrogen-Deuterium Exchange: This technique can reveal regions of MT-ND3 that are accessible to solvent and undergo conformational changes during catalysis.

  • Site-Specific Labeling: Incorporation of isotopically labeled amino acids at specific positions can provide insights into local conformational changes and interactions.

  • Cross-linking Combined with Mass Spectrometry: Isotopically labeled cross-linkers can identify interaction partners of MT-ND3 within Complex I.

  • Solid-State NMR: Although challenging for membrane proteins, isotope labeling can enable NMR studies of specific regions of MT-ND3.

These approaches can be particularly valuable for understanding how mutations in MT-ND3 affect its dynamics and function within Complex I.

What biocomputational approaches can predict the impact of novel MT-ND3 mutations?

Several computational methods can help predict the functional consequences of MT-ND3 mutations:

  • Molecular Dynamics Simulations: These can model the structural consequences of amino acid substitutions in MT-ND3, particularly in terms of local conformational changes and stability.

  • Sequence Conservation Analysis: Tools that evaluate evolutionary conservation can identify critical residues where mutations are likely to be deleterious.

  • Machine Learning Approaches: Algorithms trained on known pathogenic mutations can predict the likelihood that novel variants will be disease-causing.

  • Energy Calculations: Methods that estimate changes in protein folding energy can predict whether mutations will destabilize MT-ND3.

  • Protein-Protein Interaction Modeling: Computational approaches can predict how mutations might affect the interaction of MT-ND3 with other Complex I subunits.

  • Electrostatic Surface Mapping: These calculations can reveal how mutations might alter the electrostatic properties of MT-ND3, potentially affecting proton translocation or ubiquinone binding.

For example, mutations affecting residues similar to the A47 position in human MT-ND3 could be predicted to disrupt function based on the established pathogenicity of the A47T mutation and the high conservation of this residue across species .

How can researchers address poor expression or stability of recombinant Phyllotis darwini MT-ND3?

Recombinant expression of mitochondrial proteins like MT-ND3 often encounters challenges that can be addressed through the following approaches:

  • Codon Optimization: Adapt the codon usage to the expression system while accounting for differences between mitochondrial and standard genetic codes.

  • Expression Tags: Consider fusion tags that enhance solubility (e.g., MBP, SUMO) while being mindful that these may need to be removed for functional studies.

  • Expression Conditions: Optimize temperature, induction time, and media composition; lower temperatures (16-20°C) often improve folding of membrane proteins.

  • Detergent Screening: Test multiple detergents for extraction and purification, as MT-ND3 stability is highly dependent on the membrane-mimetic environment.

  • Co-expression Strategies: Express MT-ND3 alongside interacting subunits to promote proper folding and assembly.

  • Cell-Free Systems: Consider cell-free expression systems that allow direct incorporation into liposomes or nanodiscs.

  • Stabilizing Mutations: Introduce mutations known to enhance stability without affecting function, based on comparative sequence analysis.

What are the most common pitfalls in measuring Complex I activity with recombinant MT-ND3?

Accurate measurement of Complex I activity involving recombinant MT-ND3 requires awareness of several potential issues:

  • Incomplete Assembly: Recombinant MT-ND3 may not fully incorporate into Complex I, leading to misleading activity measurements. Use Blue Native PAGE to verify assembly status .

  • Substrate Limitations: Ensure sufficient NADH and ubiquinone concentrations; commercial ubiquinone preparations may vary in quality and solubility.

  • Alternative NADH Oxidation Pathways: Non-Complex I NADH oxidation can confound measurements, particularly in plant and fungal systems that have multiple NAD(P)H dehydrogenases . Use rotenone sensitivity to distinguish Complex I activity.

  • Detergent Effects: Detergents used for solubilization can affect enzyme activity; optimize concentration and type for maximum activity preservation.

  • Redox State Management: The redox state of Complex I affects inhibitor binding and activity. For example, labeling of Na+-NQR by inhibitor derivatives decreased significantly in the presence of NADH due to reduction-induced structural changes .

  • Temperature and pH Sensitivity: Complex I activity is highly dependent on these parameters; maintain consistent conditions across experiments.

  • Flavin Content: Loss of FMN from Complex I can cause inactivation; verify flavin content using fluorescence methods .

How can inconsistent results in MT-ND3 mutation analysis be resolved?

Variability in MT-ND3 mutation analysis can arise from several sources that require specific troubleshooting approaches:

  • Heteroplasmy Fluctuations: Mitochondrial DNA heteroplasmy levels can vary between samples and cell passages. Standardize cell culture conditions and passage numbers, and always measure heteroplasmy in parallel with functional assays .

  • Primer Design for Mutation Detection: Suboptimal primers can lead to inconsistent ARMS-PCR results. Design primers carefully and validate with samples of known heteroplasmy levels. As demonstrated in one study, optimal primer sets can produce standard curves where the experimental value closely matches the theoretical value (slope ~1) .

  • Nuclear Genetic Background: Nuclear genes can modify the phenotypic expression of MT-ND3 mutations. Use cybrid cell approaches to isolate the effects of mitochondrial mutations on a consistent nuclear background .

  • Tissue-Specific Effects: MT-ND3 mutation effects can vary between tissue types. When possible, analyze multiple tissue types or cell lineages .

  • Quantification Method Validation: Validate quantitative methods like ARMS-PCR by testing known mixtures of wild-type and mutant DNA at various ratios (0-100%) to establish accurate standard curves .

  • Sample Purification: Ensure mitochondrial isolation procedures effectively remove contaminating RNA or DNA by including RNase treatments and appropriate washing steps .

  • Controls for MT-ND3 Delivery: When delivering recombinant MT-ND3 or mRNA, include controls to verify mitochondrial targeting by isolating mitochondria and removing material bound to the outer surface .

What emerging technologies hold promise for advancing Phyllotis darwini MT-ND3 research?

Several cutting-edge technologies show potential for advancing MT-ND3 research:

  • CRISPR-Based Mitochondrial Genome Editing: Emerging technologies for direct editing of mitochondrial DNA could allow precise modification of MT-ND3 in living cells.

  • Single-Molecule Techniques: Methods like single-molecule FRET could reveal dynamic conformational changes in MT-ND3 during the catalytic cycle.

  • Cryo-Electron Tomography: This technique could potentially visualize Complex I containing MT-ND3 in its native membrane environment.

  • Nanobodies and Aptamers: These tools could be developed to specifically target MT-ND3, allowing for precise manipulation and visualization.

  • Organoid Models: Tissue-specific organoids could provide more physiologically relevant contexts for studying MT-ND3 function and dysfunction.

  • Microfluidic Platforms: These could enable high-throughput analysis of MT-ND3 variants and potential therapeutic compounds.

  • In Vivo Mitochondrial Imaging: Advanced imaging techniques could allow real-time monitoring of Complex I activity in living systems.

How might comparative studies of MT-ND3 across species inform human disease research?

Cross-species MT-ND3 studies offer valuable insights for human disease research:

  • Natural Resistance Mechanisms: Some species may have evolved mechanisms to tolerate MT-ND3 variants that would be pathogenic in humans, potentially revealing compensatory pathways.

  • Functional Conservation Mapping: Identifying residues that are invariant across diverse species, including Phyllotis darwini, can pinpoint positions where mutations are likely to be pathogenic in humans .

  • Species-Specific Energy Requirements: Understanding how MT-ND3 function relates to different metabolic demands across species could inform therapeutic approaches for human mitochondrial diseases.

  • Evolutionary Adaptations: Studying how MT-ND3 has adapted to different environmental conditions might reveal flexibility in Complex I function that could be exploited therapeutically.

  • Alternative Complex I Assemblies: Some species have variations in Complex I composition that might suggest alternative approaches to maintaining function when MT-ND3 is compromised.

What interdisciplinary approaches might yield new insights into MT-ND3 function?

Integrating multiple disciplines could accelerate MT-ND3 research:

  • Systems Biology: Combining proteomics, metabolomics, and computational modeling to understand how MT-ND3 functions within the broader cellular network.

  • Synthetic Biology: Engineering minimal versions of Complex I or hybrid complexes to understand the essential functions of MT-ND3.

  • Quantum Biology: Investigating quantum mechanical aspects of electron transfer through Complex I, potentially revealing subtle effects of MT-ND3 mutations.

  • Evolutionary Medicine: Studying how MT-ND3 has evolved across species in response to different environmental pressures could inform therapeutic approaches.

  • Bioengineering: Developing biomimetic energy conversion systems based on the principles of Complex I function.

  • Machine Learning: Applying artificial intelligence to predict mutation effects, identify patterns in experimental data, and design targeted therapeutic strategies.

  • Translational Research: Bridging basic MT-ND3 research with clinical applications by developing biomarkers and therapeutic approaches for mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.