Recombinant Physcomitrella patens subsp. patens Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-319
Protein Length
Full Length of Mature Protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
petA
Target Protein Sequence
YPIFAQQAYEDPREATGRIVCANCHLAKKPVDIEVPQSVLPDTVFEAVVKIPYDMQIKQV LANGKKGALNVGAVLILPKGFELAPADRIPPEMKEKIGNLYFQPYSSDKKNILVIGPVPG KKYSEMVFPILSPDPAVNKEANFLKYPIYLGANRGRGQIYPDGSKSNNTVYNASAAGTVS KIFRKEKGGYEITIDTQDGRQIVDIVPAGPELIISEGELIKADQPLTNNPNVGGFGQGDA EIVLQDPLRVQSLLVFFVSVTLAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Physcomitrella patens and why is it valuable as a model organism for studying petA?

Physcomitrella patens (recently reclassified as Physcomitrium patens) is a moss that has emerged as a powerful model system for plant biology. It offers unique advantages for studying genes like petA due to several key characteristics:

  • Its genome has been completely sequenced (511 Mb with 27 pseudochromosomes)

  • It exhibits an exceptionally high rate of homologous recombination, enabling precise gene targeting

  • It has a dominant haploid phase in its life cycle, allowing direct phenotypic observation of genetic modifications

  • It shares significant genomic homology with flowering plants (>66% of Arabidopsis thaliana proteins have homologs in P. patens)

  • It provides an evolutionary perspective as a bryophyte, representing early land plant adaptations

The petA gene specifically encodes Apocytochrome f, a critical component of the photosynthetic electron transport chain in the chloroplast. Studying this protein in P. patens offers insights into both evolutionary conservation of photosynthetic machinery and specialized adaptations in bryophytes.

What are the established protocols for expressing recombinant Physcomitrella patens petA in heterologous systems?

The expression of recombinant P. patens Apocytochrome f (petA) can be accomplished through several methodologies:

E. coli Expression System:

  • Clone the petA coding sequence (amino acids 36-319) into an expression vector with an N-terminal His-tag

  • Transform into an E. coli expression strain (BL21 or similar)

  • Induce protein expression with IPTG under optimized conditions

  • Purify using nickel affinity chromatography

  • Perform buffer exchange to a Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Lyophilize for storage or maintain in solution with 50% glycerol at -80°C

P. patens Native Expression:
For expression within P. patens itself:

  • Create a targeting construct containing the petA gene with desired modifications

  • Transform P. patens protoplasts using PEG-mediated DNA uptake

  • Select transformants on appropriate antibiotic media

  • Confirm integration by PCR and sequencing

  • Analyze protein expression through western blotting

The recombinant protein typically exhibits better stability when expressed with chaperones or in systems that facilitate proper heme incorporation, which is essential for functional studies.

How can I efficiently generate targeted knockout or modifications of the petA gene in Physcomitrella patens?

There are three primary approaches for targeted modification of the petA gene in P. patens:

1. Traditional Gene Targeting:

  • Design a knockout cassette with 500-1000 bp homology arms flanking a selection marker

  • Transform into protoplasts using the following protocol:

    • Isolate protoplasts from 7-day-old protonemal tissue using 2% Driselase

    • Prepare DNA construct (linearized) at 15-20 μg per transformation

    • Mix protoplasts with DNA and PEG solution (final concentration ~30%)

    • Perform heat shock at 45°C for 5 minutes

    • Allow regeneration on PRMB medium for 5-7 days

    • Transfer to selection medium

  • Screen transformants by PCR to confirm proper integration

  • The efficiency for petA targeting is typically 40-60% when using appropriate homology arms

2. CRISPR-Cas9 System:

  • Design sgRNA targeting petA with minimal off-target potential

  • Co-transform sgRNA and Cas9 expression constructs into protoplasts

  • For petA modifications, efficiency reaches up to 55% for single-base mutations without off-targets

  • For improved efficiency (~90%), implement a co-editing selection system like SMART (Selecting Modification of APRT to Report gene Targeting)

3. Base Editing Approach:

  • Use cytosine or adenine base editors for precise single nucleotide modifications

  • Target specific codons within petA to create desired amino acid changes

  • This approach achieves up to 55% editing efficiency without requiring double-strand breaks

Table 1: Comparison of Gene Modification Approaches for petA in P. patens

ApproachEfficiencyAdvantagesLimitations
Traditional Gene Targeting40-60%No need for CRISPR components; Well-establishedRequires selection marker; May have concatemer insertion
CRISPR-Cas955-90%Marker-free options; Multiple targets possiblePotential off-targets; Requires optimization
Base EditingUp to 55%Precise single-base changes; No DSB requiredLimited to C→T or A→G conversions; Restricted editing window

How does the chloroplast genome organization in Physcomitrella patens affect petA expression compared to other plant models?

The chloroplast genome organization in P. patens exhibits several unique features that influence petA expression in ways that differ from other plant models:

Genomic Context and Rearrangements:

  • The P. patens chloroplast genome is 122,890 bp in length

  • Unlike liverworts and hornworts, P. patens has undergone a major 71 kb inversion in the chloroplast genome, affecting the region from petD to rpoB

  • This inversion appears to be unique to P. patens and is not found in other moss species like Ceratodon purpureus, Plagiothecium euryphyllum, Hylocomium splendens, and Bartramia pomiformis

  • The endpoints of this inversion lie between rps11 and rpoB at one end and petD and trnC-GCA at the other

Transcriptional Regulation:

  • In P. patens, chloroplast genes are often organized in clusters and co-transcribed as polycistronic RNAs

  • These precursor RNAs undergo post-transcriptional processing to produce mature, translatable mRNAs

  • The expression of chloroplast genes like petA is regulated by nuclear-encoded pentatricopeptide repeat (PPR) proteins, which affect RNA stability and processing

Evolutionary Implications:

  • Despite genome rearrangements, the petA gene function remains conserved across land plants, indicating strong selection pressure on photosynthetic machinery

  • The chloroplast gene content in P. patens differs from liverworts and hornworts, suggesting lineage-specific adaptations

These distinctive genomic features provide researchers with unique opportunities to study the evolution of plastid gene expression and the effects of large-scale genomic rearrangements on gene function.

How do stress conditions affect petA expression and function in Physcomitrella patens?

Stress conditions significantly impact petA expression and function in P. patens, providing important insights into chloroplast responses to environmental challenges:

Effect of Abiotic Stresses:

  • Salinity Stress:

    • Induces up-regulation of light-harvesting chlorophyll proteins and components of the electron transport chain

    • Results show increased abundance of photosynthetic proteins, including components that interact with Apocytochrome f

    • This response differs from salt-sensitive plants that typically down-regulate photosynthetic machinery

  • Low-Temperature Stress:

    • Generally down-regulates photosynthetic protein abundance

    • Simultaneously up-regulates stress-related proteins and certain Calvin cycle components

    • These adjustments help maintain energy balance under suboptimal conditions

  • Protoplastation Stress:

    • During protoplast isolation (which mimics drought/salinity stress), rapid changes occur in chloroplast proteome

    • Linear electron transport rates decrease progressively during Driselase treatment, affecting the functional activity of chloroplasts

    • PSII quantum yields diminish under these conditions, likely affecting the electron flow to Cytochrome f

Effect of Biotic Stress:

Upon pathogen infection (e.g., Botrytis cinerea):

Response Measurements:

![Decrease in functional activity of chloroplasts during stress](https://www.frontiersin.org/files/Articles/270330/fpls-07-01661-HTML/ima graph demonstrates how stress conditions (specifically Driselase treatment, which mimics biotic stress) progressively reduce the functional activity of chloroplasts, including electron transport chains where Apocytochrome f operates. The decrease in PSII quantum yield has direct implications for electron flow through the cytochrome b6f complex where Apocytochrome f functions .

How does the structure and function of petA in Physcomitrella patens compare to that in vascular plants?

The petA gene in P. patens shares fundamental similarities with its counterparts in vascular plants, but also exhibits moss-specific features:

Structural Comparisons:

  • The core functional domains of Apocytochrome f are highly conserved between P. patens and vascular plants

  • Both contain the characteristic heme-binding CXXCH motif essential for electron transport

  • The P. patens Apocytochrome f mature protein (284 amino acids) is similar in length to those found in angiosperms

Functional Conservation:

  • In both P. patens and vascular plants, Apocytochrome f functions as part of the cytochrome b6f complex, mediating electron transfer between photosystems

  • Knockout studies indicate that disruption of petA or related components reduces formation of photosystem complexes in both moss and flowering plants

  • The electron transport chain fundamentals remain conserved despite 450+ million years of evolutionary divergence

Evolutionary Distinctions:

  • While the protein function is conserved, the genomic context differs significantly

  • P. patens has experienced a major inversion in the chloroplast genome (71 kb region from petD to rpoB) not found in other plant lineages

  • Regulatory mechanisms governing petA expression may differ between mosses and vascular plants

  • P. patens lacks certain genes found in liverworts and hornworts (rpoA, cysA, cysT and ccsA) while maintaining petA, suggesting differential selective pressures on chloroplast genes

Evolutionary Implications:
This comparative analysis provides insight into the core photosynthetic machinery that was established before the divergence of mosses and vascular plants, highlighting both the essential conserved elements and the flexibility for genomic rearrangements without compromising function.

What gene editing approaches for petA in Physcomitrella patens could have applications in other plant systems?

Several gene editing approaches developed for petA in P. patens hold significant potential for application in other plant systems:

1. Base Editing Technology:

  • P. patens has been used to pioneer both cytosine and adenine base editors for precise single nucleotide modifications

  • These systems achieve up to 55% efficiency without off-target mutations in P. patens

  • The APRT co-editing selection system developed in P. patens (SMART) increases efficiency to ~90%

  • This high-precision approach could be valuable for crops where subtle modifications to photosynthetic genes might enhance efficiency without triggering regulatory concerns about transgenic modifications

2. Homology-Directed Repair Enhancement:

  • Studies in P. patens have identified factors that enhance homologous recombination efficiency

  • These include the role of RAD51, which is essential for efficient gene targeting

  • The unique features of the P. patens DNA repair machinery (absence of BRCA1, BRCA2, and BARD1, duplicated RAD51, and phylogenetically conserved RAD54B, CENTRINS and CHD7) provide insights for potentially enhancing HDR in crop plants

  • These findings could guide the development of improved gene targeting strategies in crops where HDR efficiency is typically low

3. Multiplex Gene Editing:

  • P. patens systems for simultaneous editing of multiple targets could translate to other plants

  • The modular CRISPR-Cas9 vector system developed for P. patens allows expression of Cas9 and multiple sgRNAs simultaneously

  • This system enables targeting up to 12 genome sites in a single transformation

  • Similar approaches could enhance efficiency in crop improvement programs requiring modifications to multiple genes in metabolic or stress response pathways

4. RNA-Guided CRISPR-Cas Systems:

  • P. patens has been used to optimize various aspects of CRISPR-Cas technology including:

    • Promoter selection for sgRNA expression (U6 promoter optimization)

    • Cas9 codon optimization for plant expression

    • Precise methods for inducing specific mutations

  • These optimizations provide valuable design principles for applying similar approaches in crop species

The comparative ease of confirming and characterizing edits in the haploid P. patens system makes it an excellent platform for testing novel editing approaches before translation to more complex plant systems.

What are the common challenges in working with recombinant Physcomitrella patens petA protein and how can they be overcome?

Researchers working with recombinant P. patens Apocytochrome f (petA) protein encounter several challenges, each with specific solutions:

1. Protein Solubility and Stability Issues:

Challenge: Apocytochrome f contains hydrophobic transmembrane domains that can cause aggregation during expression and purification.

Solutions:

  • Express as a fusion with solubility-enhancing tags (His-tag is commonly used)

  • Optimize buffer conditions: Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been effective

  • Add glycerol (30-50%) to storage buffers to prevent aggregation

  • Consider expressing only the soluble domain for certain applications

  • Avoid repeated freeze-thaw cycles which significantly reduce activity

2. Functional Reconstitution:

Challenge: Obtaining properly folded protein with correctly incorporated heme group.

Solutions:

  • Co-express with chaperone proteins to assist folding

  • Add heme precursors to the growth medium during expression

  • Use specialized E. coli strains designed for membrane protein expression

  • Perform in vitro heme reconstitution if necessary

  • Verify heme incorporation spectroscopically before functional studies

3. Expression Level Optimization:

Challenge: Low expression yields in heterologous systems.

Solutions:

  • Optimize codon usage for the expression host

  • Test multiple promoter systems (T7, tac, etc.)

  • Adjust induction conditions (temperature, IPTG concentration, induction time)

  • Screen multiple expression hosts (BL21(DE3), C41/C43, etc.)

  • Consider insect cell or yeast expression systems for improved folding

4. Functional Activity Assessment:

Challenge: Verifying that the recombinant protein maintains native electron transfer capability.

Solutions:

  • Develop in vitro electron transfer assays using artificial electron donors/acceptors

  • Measure heme redox potentials using spectroelectrochemical techniques

  • Reconstitute with minimal electron transport components

  • Use fluorescent probes sensitive to electron transfer events

  • Perform complementation studies in mutant strains

5. Storage and Stability:

Challenge: Maintaining protein activity during storage.

Solutions:

  • Lyophilize in the presence of stabilizing agents like trehalose

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C or -80°C with 50% glycerol

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Include reducing agents to maintain the heme in the appropriate oxidation state

How can researchers optimize protoplast transformation efficiency when targeting the petA gene in Physcomitrella patens?

Optimizing protoplast transformation for petA targeting requires attention to several key factors:

1. Protoplast Preparation and Quality:

Optimized Protocol:

  • Use 7-day-old protonema cultured on BCD medium supplemented with ammonium tartrate

  • Digest with 2% Driselase for exactly 45 minutes at room temperature with gentle shaking

  • Monitor digestion progress microscopically to avoid over-digestion

  • Purify protoplasts through sequential filtration and centrifugation steps

  • Assess viability with fluorescein diacetate staining (>90% viability is optimal)

  • Maintain protoplast density at 1.6 × 106 protoplasts/mL

Key Consideration: The physiological state of starting material significantly affects transformation success. Protonemal tissue in the exponential growth phase yields the healthiest protoplasts.

2. DNA Construction and Preparation:

Optimization Strategies:

  • For petA targeting, use homology arms of 500-1000 bp flanking the target region

  • Ensure DNA purity by using endotoxin-free plasmid preparation kits

  • Linearize constructs with high-fidelity restriction enzymes

  • Use 15-20 μg of DNA per transformation

  • For CRISPR-Cas9 approaches, maintain a 1:1 ratio of Cas9 and sgRNA plasmids

Key Consideration: The structure of the targeting construct significantly impacts recombination efficiency. For petA, which is located in the chloroplast genome, longer homology arms may be necessary compared to nuclear genes.

3. Transformation Conditions:

Optimized Protocol:

  • Mix DNA, protoplasts, and PEG 4000 (final concentration 30-40%)

  • Apply heat shock at 45°C for 5 minutes to enhance DNA uptake

  • Include a 10-minute room temperature incubation after heat shock

  • Dilute step-wise with regeneration medium to avoid osmotic shock

  • Plate on PRMB medium overlaid with cellophane

Key Parameters to Optimize:

  • PEG concentration (30-40%)

  • Heat shock duration (3-7 minutes)

  • DNA:protoplast ratio

  • Recovery time before selection

4. Selection and Regeneration:

Strategies for Improved Recovery:

  • Begin selection after 5-7 days of regeneration on non-selective medium

  • For petA targeting, monitor photosynthetic phenotypes alongside antibiotic selection

  • Use mannitol as an osmoticum in regeneration media (6-8%)

  • Maintain cultures under reduced light intensity during early regeneration

  • Consider step-wise increase in antibiotic concentration for gentler selection

5. Advanced Techniques for Enhanced Efficiency:

  • Co-express proteins that enhance homologous recombination (e.g., RAD51)

  • For CRISPR-based approaches, implement the SMART co-editing selection system for up to 90% efficiency

  • Use base editors for petA modifications that don't require double-strand breaks

  • Consider transient silencing of NHEJ pathway components to favor homologous recombination

Efficiency Comparison Table:

ApproachStandard EfficiencyOptimized EfficiencyKey Optimization Factors
Traditional HR40-50%Up to 60%Homology arm length, DNA quality, heat shock
CRISPR-Cas930-40%Up to 55%sgRNA design, Cas9:sgRNA ratio, promoter choice
Base Editing40-50%Up to 90% with SMARTCo-editing design, base editor variant selection

How might synthetic biology approaches using petA in Physcomitrella patens contribute to improved photosynthetic efficiency?

Synthetic biology approaches using petA in P. patens offer promising avenues for enhancing photosynthetic efficiency through several innovative strategies:

1. Engineering Optimized Electron Transport:

The petA gene encodes Apocytochrome f, a key component of the cytochrome b6f complex that often represents a rate-limiting step in photosynthetic electron transport. Targeted modifications could:

  • Adjust the redox potential of the heme group to optimize electron flow rates

  • Engineer variants with altered binding affinities for plastocyanin to reduce bottlenecks

  • Create versions with enhanced stability under fluctuating light conditions

  • Introduce mutations that reduce susceptibility to photoinhibition

2. Design of Minimal Artificial Photosynthetic Units:

P. patens offers an excellent chassis for testing minimal artificial photosynthetic units where:

  • Simplified electron transport chains including modified petA could be designed

  • Alternative electron donors/acceptors could be integrated

  • Novel cofactors could be incorporated to expand the spectral range of light absorption

  • Non-native electron transport components could be introduced to create hybrid systems

The high homologous recombination efficiency in P. patens facilitates precise integration of these engineered systems .

3. Evolution-Guided Optimization:

Using directed evolution approaches:

  • Libraries of petA variants could be generated using error-prone PCR or CRISPR-based methods

  • Selection under different light regimes could identify variants with enhanced performance

  • The SMART co-editing selection system could be adapted to facilitate high-throughput screening

  • Beneficial mutations identified in P. patens could potentially be transferred to crop plants

4. Multi-gene Optimization Strategies:

The ability to perform multiplex gene editing in P. patens enables:

  • Simultaneous modification of petA along with other components of the electron transport chain

  • Coordinated adjustments to both photosystems and the cytochrome b6f complex

  • Introduction of entire alternative electron transport pathways

  • Balancing modifications across multiple complexes to avoid creating new bottlenecks

5. Stress-Tolerant Photosynthetic Machinery:

Engineering petA and related components for enhanced stress tolerance:

  • Create variants that maintain efficiency under drought or high salt conditions

  • Develop temperature-tolerant versions by incorporating features from extremophile organisms

  • Design variants with reduced susceptibility to reactive oxygen species damage

  • Introduce regulatory elements that allow dynamic responses to changing conditions

The P. patens system is particularly valuable for these approaches due to its:

  • High gene targeting efficiency (up to 90% with optimized protocols)

  • Haploid gametophyte dominant lifecycle allowing immediate phenotype assessment

  • Simple tissue organization facilitating rapid photosynthetic phenotyping

  • Evolutionary position providing insights into adaptations during land plant evolution

These synthetic biology approaches in P. patens could serve as proof-of-concept studies that eventually translate to crop improvement strategies aimed at enhancing agricultural productivity under challenging environmental conditions.

What are the emerging technologies for studying the role of petA in chloroplast biogenesis and function?

Several cutting-edge technologies are transforming our ability to study petA's role in chloroplast biogenesis and function in P. patens:

1. Advanced Genome Editing Technologies:

CRISPR Prime Editing:

  • Allows precise nucleotide replacements without double-strand breaks

  • Enables subtle modifications to petA regulatory regions without introducing selection markers

  • Can create specific amino acid substitutions to study structure-function relationships

  • This technology builds upon the established base editing systems in P. patens

Inducible CRISPR Systems:

  • Temporal control of petA modifications using chemically-inducible or light-responsive Cas9 variants

  • Allows study of petA function at different developmental stages

  • Enables creation of conditional mutations for studying essential functions

  • P. patens already has established inducible systems (dexamethasone, heat-shock, and homoserine-lactone) that could be adapted for CRISPR regulation

2. Advanced Imaging Technologies:

Super-Resolution Microscopy:

  • Visualizes the spatial organization of petA within the thylakoid membrane

  • Tracks dynamic changes in protein localization during chloroplast development

  • P. patens is particularly amenable to imaging studies due to its simple tissue organization

Cryo-Electron Tomography:

  • Provides structural insights into the integration of petA within the cytochrome b6f complex in near-native conditions

  • Reveals how mutations affect complex assembly and membrane organization

  • Captures structural dynamics during electron transport events

3. Proteomics Approaches:

Quantitative Redox Proteomics:

  • Measures the oxidation states of petA and interacting proteins under different conditions

  • Maps post-translational modifications that regulate electron transport activity

  • Identifies redox-sensitive residues critical for function

  • P. patens has been successfully used in proteomic studies examining chloroplast responses to various stresses

Proximity Labeling:

  • BioID or APEX2 fusions with petA to identify transient interaction partners

  • Maps the dynamic protein interaction network during chloroplast development

  • Identifies previously unknown regulatory proteins controlling petA function

4. Multi-omics Integration:

Systems Biology Approaches:

Comparative Phylogenomics:

  • Leverages the evolutionary position of P. patens to identify conserved and lineage-specific features of petA regulation

  • Identifies regulatory elements that have been maintained across 450+ million years of plant evolution

5. Single-Cell Technologies:

Single-Cell Transcriptomics:

  • Captures cell-type specific expression patterns of nuclear genes regulating petA

  • Reveals heterogeneity in chloroplast development across different tissue types

  • P. patens protonemal cells are particularly amenable to single-cell analysis

Live-Cell Biosensors:

  • Genetically encoded sensors to measure electron transport rates in real-time

  • FRET-based systems to detect conformational changes during cytochrome function

  • Redox-sensitive fluorescent proteins to visualize electron flow through the petA-containing complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.