Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_108355 (PHYPADRAFT_108355)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format preference, please indicate your requirement in the order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for specific delivery time information.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, storage temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PHYPADRAFT_108355; CASP-like protein 1U4; PpCASPL1U4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_108355
Target Protein Sequence
MADVSIPVSEPFNAKKGSPYNNGGLAPRAYDDAPQKGHRVHHCLNFIVRLLTAMASAAAL TTMVKSNQGPARWRDFWAFKWFIIANAIVLTYSTLAALASLLGEWTRRGPLSSTPLAWLT FLVDFLLANALMSAASTATAISWVGRKGQPNAGWEAQCVAVGGFCRRVLGALIASYIGWV LLALSTILAATAIHRLRRRSAVAN
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PHYPADRAFT_108355 and how is it classified?

PHYPADRAFT_108355 is a CASP-like (Casparian strip membrane domain-like) protein found in the moss Physcomitrella patens. It belongs to the UPF0497 protein family, which includes 39 members in Arabidopsis thaliana that are categorized into six subfamilies . CASP-like proteins are evolutionarily related to the MARVEL (MAL and related proteins for vesicle trafficking and membrane link) protein family, which until recently had only been experimentally characterized in metazoans . PHYPADRAFT_108355 likely contains four transmembrane domains, similar to other characterized CASP-like proteins such as AtCASPL4C1 and ClCASPL .

What are the predicted structural features of PHYPADRAFT_108355?

Based on structural analysis of related CASP-like proteins, PHYPADRAFT_108355 likely possesses four transmembrane (TM) domains. In similar proteins like ClCASPL from watermelon, these domains span approximately amino acids 45-67, 87-109, 130-149, and 169-191 . The protein is expected to localize to the plasma membrane, as confirmed through fluorescence microscopy analysis of related CASP-like proteins tagged with GFP . Like other members of this family, PHYPADRAFT_108355 likely forms part of a polymeric platform that may guide the assembly and activity of enzymes involved in cell wall modification, particularly lignin biosynthesis .

How does PHYPADRAFT_108355 differ from canonical CASP proteins?

While canonical CASP proteins (CASP1/2/3/4/5) in vascular plants like Arabidopsis are primarily associated with Casparian strip formation in the root endodermis , CASP-like proteins such as PHYPADRAFT_108355 appear to have more diverse functions. Studies of orthologous proteins suggest PHYPADRAFT_108355 may be involved in cold stress responses and potentially in fundamental aspects of vascular tissue development that extend beyond Casparian strip formation . This functional divergence is particularly interesting in Physcomitrella patens, which as a non-vascular plant lacks the typical endodermal structures found in higher plants where canonical CASPs function .

What techniques are most effective for studying the membrane localization of PHYPADRAFT_108355?

For investigating membrane localization, a combined approach using both computational prediction and experimental verification is recommended. Begin with transmembrane domain prediction using multiple algorithms such as TMHMM, Phobius, and TOPCONS to generate a consensus model . For experimental verification, construct a PHYPADRAFT_108355-GFP fusion protein expressed under either its native promoter or a constitutive promoter like 35S. Transform this construct into Physcomitrella patens using established protocols for homologous recombination, taking advantage of P. patens' high efficiency in this process .

For visualization, confocal laser scanning microscopy of the resulting transgenic lines provides high-resolution imaging of subcellular localization. Co-localization studies with established plasma membrane markers such as PIP aquaporins can confirm membrane association. For more detailed analysis, perform membrane fractionation followed by Western blotting to biochemically verify the presence of PHYPADRAFT_108355 in the membrane fraction .

How might PHYPADRAFT_108355 function in cold stress response pathways in Physcomitrella patens?

Analysis of orthologous CASP-like proteins indicates a potential role in cold stress response. Based on studies of ClCASPL in watermelon and AtCASPL4C1 in Arabidopsis, PHYPADRAFT_108355 may function as a negative regulator of cold tolerance . To investigate this:

  • Generate knockout lines using CRISPR-Cas9 or homologous recombination

  • Create overexpression lines using strong constitutive promoters

  • Subject both modified lines to controlled cold stress conditions

  • Measure physiological parameters including:

    • Electrolyte leakage

    • Photosynthetic efficiency (Fv/Fm)

    • Lipid membrane composition

    • Antioxidant enzyme activities

    • Accumulation of compatible solutes

Expression analysis under cold conditions can be performed using qRT-PCR to determine if PHYPADRAFT_108355 is cold-inducible, similar to its orthologs . RNA-seq comparisons between wild-type, knockout, and overexpression lines under normal and cold conditions would reveal downstream pathways affected by this protein.

What is the evolutionary significance of PHYPADRAFT_108355 in non-vascular plants?

The presence of CASP-like proteins in non-vascular plants represents an evolutionarily significant phenomenon, as canonical CASP proteins in vascular plants are associated with specialized structures (Casparian strips) that are absent in bryophytes like P. patens . This suggests that CASP-like proteins evolved before the emergence of vascular plants and may have been co-opted for specialized functions during land plant evolution.

To investigate the evolutionary significance:

  • Perform comprehensive phylogenetic analysis of CASP and CASP-like proteins across plant lineages including algae, bryophytes, lycophytes, ferns, gymnosperms, and angiosperms

  • Identify conserved motifs and domains using tools like MEME and HMMER

  • Determine selection pressures using dN/dS ratio analysis

  • Use ancestral sequence reconstruction to infer the properties of the ancestral CASP-like protein

This evolutionary context provides insights into how membrane proteins diversified during land plant evolution and may reveal fundamental roles of CASP-like proteins that predate the emergence of specialized tissues in vascular plants.

What protocols are optimal for recombinant expression of PHYPADRAFT_108355?

For successful recombinant expression of PHYPADRAFT_108355, a moss-based expression system is highly recommended. The following protocol leverages P. patens' advantages as a protein production platform:

Table 1: Optimal Conditions for Recombinant Expression of PHYPADRAFT_108355

ParameterRecommended ConditionNotes
Expression SystemP. patens cell suspensionOffers proper post-translational modifications
Growth MediumBCD medium supplemented with di-ammonium tartrateAs described in established protocols
Culture Conditions27.5°C with 12hr light/dark cycleFluorescent light, ~50-70 μmol m⁻² s⁻¹
Transformation MethodPEG-mediated transformation of protoplastsTargets homologous recombination
Selection MarkerHygromycin or G418 resistanceChoose based on background strains
Targeting StrategyKnock-in at neutral locus or native locusDepends on research objectives
Protein TagC-terminal His6 or Strep-tagN-terminal tags may interfere with membrane insertion
InductionConstitutive or inducible promoterHeat-shock or chemical induction available
ExtractionDetergent-based membrane protein extractionTriton X-100 or n-dodecyl-β-D-maltoside

This approach takes advantage of P. patens' efficient homologous recombination, which allows precise genetic modifications and stable integration of expression constructs . For membrane proteins like PHYPADRAFT_108355, P. patens offers appropriate post-translational modifications and proper membrane insertion mechanisms, which may be crucial for obtaining functional protein .

How can knockout mutants of PHYPADRAFT_108355 be generated and characterized in P. patens?

Generating knockout mutants of PHYPADRAFT_108355 can be achieved through highly efficient homologous recombination in P. patens, following this systematic approach:

  • Design knockout construct: Create a construct containing a selection marker (e.g., hygromycin resistance) flanked by sequences homologous to regions upstream and downstream of PHYPADRAFT_108355 coding sequence (500-1000 bp each).

  • Transform P. patens protoplasts: Isolate protoplasts from protonema tissue using driselase digestion and transform using PEG-mediated transformation .

  • Selection and regeneration: Culture transformed protoplasts on BCD medium containing appropriate selection antibiotics. Surviving colonies should be subcultured to establish stable lines .

  • Genotyping verification:

    • PCR confirmation of gene replacement

    • Southern blot to verify single integration

    • RT-PCR to confirm absence of transcript

  • Phenotypic characterization:

    • Growth rate and morphological analysis under standard conditions

    • Cold stress tolerance assessment (based on orthologous protein function)

    • Microscopic examination of cell wall structures

    • Lipidomic analysis to detect membrane composition changes

    • Transcriptomic profiling to identify affected pathways

Based on studies of related CASP-like proteins, knockout mutants may exhibit altered growth dynamics, potentially faster growth, increased biomass, and earlier developmental transitions compared to wild-type plants . Additionally, enhanced tolerance to cold stress might be observed, similar to AtCASPL4C1 knockout plants in Arabidopsis .

What analytical techniques best determine the interaction partners of PHYPADRAFT_108355?

Identifying interaction partners is crucial for understanding PHYPADRAFT_108355 function. A multi-faceted approach combining in vivo and in vitro techniques is recommended:

  • Co-immunoprecipitation (Co-IP): Express tagged PHYPADRAFT_108355 in P. patens, isolate membrane fractions, solubilize with mild detergents, and perform pull-down assays followed by mass spectrometry.

  • Proximity-based labeling: Fuse PHYPADRAFT_108355 with BioID or TurboID to biotinylate nearby proteins in vivo, allowing streptavidin-based purification and identification.

  • Split-fluorescent protein complementation: Test candidate interactions by fusing PHYPADRAFT_108355 and potential partners with complementary fragments of a fluorescent protein (e.g., split-YFP).

  • Membrane yeast two-hybrid (MYTH): Particularly suitable for membrane proteins, this modified Y2H system can detect interactions in a membrane context.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinking followed by mass spectrometry can capture transient or weak interactions.

Based on studies of related proteins, potential interaction partners may include:

  • Enzymes involved in lignin biosynthesis

  • Membrane-localized stress response proteins

  • Cell wall remodeling enzymes

  • Cytoskeletal anchoring proteins

  • Other CASP-like family members for potential oligomerization

How should researchers interpret contradictory data regarding PHYPADRAFT_108355 function?

When faced with contradictory data regarding PHYPADRAFT_108355 function, consider these systematic approaches:

  • Evaluate experimental contexts: Different phenotypes may emerge under varying conditions. For example, studies of related AtCASPL4C1 showed that knockout effects were most pronounced under cold stress conditions but less evident under standard growth conditions .

  • Consider genetic redundancy: The CASP-like family contains multiple members that may have overlapping functions. Single gene knockout might be compensated by related genes, requiring multiple gene knockouts to reveal phenotypes.

  • Analyze tissue-specific effects: Expression patterns may vary across tissues and developmental stages. Use reporter gene constructs (like GUS) to determine where and when PHYPADRAFT_108355 is expressed .

  • Compare across evolutionary context: Contradictions may reflect evolutionary divergence in function. Comparing PHYPADRAFT_108355 function in P. patens with orthologs in vascular plants can reveal both conserved and divergent aspects .

  • Validate with multiple approaches: Combine genetic, biochemical, and cell biological approaches to build a comprehensive understanding that resolves apparent contradictions.

Specifically for CASP-like proteins, contradictions have been observed regarding their role beyond Casparian strip formation. For instance, while canonical CASP proteins are primarily associated with Casparian strips, CASP-like proteins appear to have broader functions including cold tolerance and potentially fundamental roles in vascular tissue .

What bioinformatic pipelines are most appropriate for analyzing PHYPADRAFT_108355 from genomic data?

For comprehensive bioinformatic analysis of PHYPADRAFT_108355, implement this pipeline that addresses multiple aspects of the protein:

Table 2: Recommended Bioinformatic Analysis Pipeline for PHYPADRAFT_108355

Analysis TypeRecommended ToolsOutput/Insights
Gene StructureAUGUSTUS, FGENESHExon-intron boundaries, alternative splicing
Promoter AnalysisPlantCARE, MEMERegulatory elements, stress-responsive motifs
Protein StructureTMHMM, Phobius, I-TASSERTransmembrane topology, 3D structural models
Protein DomainsInterProScan, SMARTFunctional domains, conserved motifs
Ortholog IdentificationOrthoFinder, OrthoMCLEvolutionary relationships across species
Expression CorrelationCoExpress, WGCNACo-expressed gene networks
Subcellular LocalizationDeepLoc, TargetPPrediction of cellular compartment
Post-translational ModificationsNetPhos, NetGlycatePotential phosphorylation, glycosylation sites
Molecular DynamicsGROMACS, NAMDMembrane protein behavior simulation

For sequence alignment and phylogenetic analysis, focus on the four transmembrane regions that are characteristic of CASP family proteins . When constructing phylogenetic trees, categorize proteins into the six established subfamilies of CASP/CASP-like proteins to determine proper placement of PHYPADRAFT_108355 .

For gene expression analysis using transcriptomic data, pay particular attention to cold stress conditions, as orthologous CASP-like proteins show cold-responsive expression patterns . Additionally, compare expression across developmental stages to identify potential tissue-specific functions.

What are common challenges in expressing PHYPADRAFT_108355 and how can they be overcome?

Membrane proteins like PHYPADRAFT_108355 present several challenges during recombinant expression. Here are common issues and solutions:

  • Low expression levels:

    • Optimize codon usage for P. patens

    • Test different promoters (constitutive vs. inducible)

    • Consider using protease inhibitors during extraction

    • Implement a secretion signal if appropriate

  • Protein misfolding/aggregation:

    • Express at lower temperatures

    • Include molecular chaperones as co-expression partners

    • Use mild detergents for membrane protein extraction

    • Consider native versus denatured purification strategies

  • Difficulty in protein detection:

    • Test multiple epitope tags (His, FLAG, Strep) at both N- and C-termini

    • Use monoclonal antibodies raised against conserved CASP-like epitopes

    • Implement sensitive detection methods like Western blot with enhanced chemiluminescence

  • Unstable transgenic lines:

    • Screen multiple independent transformation events

    • Maintain selection pressure during propagation

    • Verify integration stability over multiple generations

    • Consider targeting neutral loci for stable expression

  • Poor protein yield during extraction:

    • Optimize detergent type and concentration

    • Test various buffer compositions (pH, salt concentration)

    • Implement density gradient separation for membrane fractions

    • Consider extraction from specific tissues or developmental stages with higher expression

P. patens offers advantages for membrane protein expression due to its sophisticated post-translational modification machinery and ability to properly fold complex proteins, making it particularly valuable for challenging proteins like PHYPADRAFT_108355 .

What emerging technologies could advance understanding of PHYPADRAFT_108355 function?

Several cutting-edge technologies could significantly enhance our understanding of PHYPADRAFT_108355 function:

  • Cryo-electron microscopy: With recent advances in resolution, cryo-EM could reveal the structure of PHYPADRAFT_108355 in its native membrane environment, particularly focusing on how it assembles into potential oligomeric structures similar to other CASP proteins .

  • Single-cell transcriptomics: This approach could reveal cell-type specific expression patterns of PHYPADRAFT_108355 in P. patens, identifying whether its expression is broadly distributed or restricted to specific cell types during development.

  • Optogenetics and chemogenetics: Developing tools to rapidly control PHYPADRAFT_108355 activity could help dissect its immediate versus long-term functions in cellular processes and stress responses.

  • Genome-wide CRISPR screens: Implementing CRISPR screening in P. patens could identify genetic interactors of PHYPADRAFT_108355, revealing connected pathways and functions.

  • Advanced imaging techniques: Super-resolution microscopy combined with specific labeling could track PHYPADRAFT_108355 dynamics in living cells, potentially revealing its role in membrane domain organization.

  • Synthetic biology approaches: Reconstituting PHYPADRAFT_108355 in artificial membrane systems could help determine its intrinsic properties and minimal functional partners.

  • Comparative functional genomics: Systematic comparison of PHYPADRAFT_108355 function across evolutionary diverse plant species could reveal both ancestral and derived functions of this protein family.

These approaches would build upon current understanding of CASP-like proteins, which suggests roles beyond traditional Casparian strip formation, potentially in fundamental aspects of plasma membrane organization, cold stress responses, and regulation of growth and development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.