Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_161913 (PHYPADRAFT_161913)

What is the molecular structure of PHYPADRAFT_161913 and how does it compare to other CASP-like proteins?

PHYPADRAFT_161913, also known as CASP-like protein UU6 or PpCASPLUU6 (UniProt ID: A9RZ57), is a full-length protein comprising 373 amino acids with a complete sequence: MGTLTDPTVDPADPHVKADDGAGLIDAGQVHPERLETLAEDQSQRDGANGVHFPVKTNTGNAAESTASTENGETGSIDVGKLRTKPSPVQTHIHRGGSEGLYRGASGGIYRSASGSTHIHRGASGGILRGQSGGIHRGRSGAIHLPSLQSISFSMTRLPEEDAGVMMHFTETKETETTPE SSRASDEDAPTPKKKHRLRKHLTAIGAYSFAFRFSETVLSLIAIVVMCSTRGSMRTDGVDFGTLKFNHFQAYRYLVAVNVIVFVYSTFQFIQLLYTVILGISFIPSIFISTWMTFGFDQLFLYLLLSASTSAATVANMSYTGEMGIQLCSRFDVGSFCSKADVAVTMSFFAVLAMLSSTILAIYRIAVLLREY . The protein contains several hydrophobic domains characteristic of transmembrane regions, suggesting its role in membrane organization similar to other CASP family proteins.

What expression systems are most effective for producing functional PHYPADRAFT_161913?

For PHYPADRAFT_161913 production, E. coli has been successfully employed as an expression system with N-terminal His-tagging for purification purposes . The methodology involves:

• Cloning the full-length sequence (1-373aa) into a prokaryotic expression vector

• Transforming the construct into E. coli competent cells

• Inducing protein expression under optimized conditions

• Purifying using affinity chromatography with Ni-NTA columns

• Lyophilizing the purified protein in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For researchers experiencing expression challenges with the complete protein, domain-specific expression might be considered as the protein contains multiple domains that could affect proper folding in prokaryotic systems.

How should PHYPADRAFT_161913 be stored and handled to maintain optimal activity?

Proper storage and handling of PHYPADRAFT_161913 is critical for preserving its structural integrity and functional activity. The recommended protocol includes:

Methodology for reconstitution:

• Briefly centrifuge the vial before opening to collect all material at the bottom

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended as standard)

• Aliquot for long-term storage at -20°C/-80°C

• Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

What are the optimal conditions for assaying PHYPADRAFT_161913 functionality in vitro?

When designing in vitro assays for PHYPADRAFT_161913 functionality, researchers should consider its native environment as a membrane-associated protein from moss. Effective methodological approaches include:

• Membrane reconstitution assays: Incorporating the purified protein into artificial lipid bilayers or liposomes with composition mimicking the native moss plasma membrane

• Protein-protein interaction studies: Using pull-down assays with potential interaction partners identified through bioinformatic prediction

• Buffer optimization: Testing activity in buffers containing 20-50 mM Tris-HCl (pH 7.4-8.0), 100-150 mM NaCl, and 1-5 mM DTT or β-mercaptoethanol

• Temperature sensitivity analysis: Assessing functionality at 4°C, 22°C (room temperature), and 28°C (optimal for moss proteins)

Assay validation should incorporate both positive controls (known functional CASP-family proteins) and negative controls (denatured protein) to establish baseline measurements.

How can I investigate the localization pattern of PHYPADRAFT_161913 in plant cells?

To investigate the subcellular localization of PHYPADRAFT_161913, researchers can employ multiple complementary approaches:

• Fluorescent protein fusion constructs: Generate C-terminal or N-terminal GFP/mCherry fusions being mindful of the transmembrane topology predicted from sequence analysis

• Confocal microscopy protocol:

  • Transform moss protoplasts with the fusion construct

  • Image after 24-72 hours using a confocal microscope

  • Co-stain with established organelle markers (plasma membrane, ER, Golgi)

  • Assess localization under normal conditions and various stresses

• Immunolocalization with affinity-purified antibodies:

  • Raise antibodies against unique epitopes of PHYPADRAFT_161913

  • Verify specificity via Western blot

  • Fix samples in 4% paraformaldehyde

  • Permeabilize with 0.1-0.5% Triton X-100

  • Block with 3% BSA

  • Incubate with primary antibody (1:100-1:500 dilution)

  • Detect with fluorophore-conjugated secondary antibody

  • Image using confocal microscopy

• Subcellular fractionation: Isolate different cellular compartments and analyze protein distribution via Western blotting, which provides a biochemical validation of microscopic observations.

What experimental approaches are suitable for studying protein-protein interactions involving PHYPADRAFT_161913?

Since PHYPADRAFT_161913 is a CASP-like protein potentially involved in membrane organization and signaling, several methodologies can be employed to identify and validate its interaction partners:

• Co-immunoprecipitation (Co-IP):

  • Solubilize membranes using mild detergents (0.5-1% NP-40, 0.5% digitonin)

  • Immunoprecipitate using anti-His antibodies or custom antibodies against PHYPADRAFT_161913

  • Identify binding partners through mass spectrometry analysis

  • Validate specific interactions with reverse Co-IP

• Yeast two-hybrid (Y2H) with split-ubiquitin system (suitable for membrane proteins):

  • Clone PHYPADRAFT_161913 into appropriate bait vectors

  • Screen against a moss cDNA library

  • Verify positive interactions through growth on selective media and reporter gene activation

• Proximity-labeling approaches:

  • Generate BioID or TurboID fusions with PHYPADRAFT_161913

  • Express in Physcomitrella patens

  • Add biotin for labeling proximal proteins

  • Purify biotinylated proteins using streptavidin

  • Identify through mass spectrometry

• Förster Resonance Energy Transfer (FRET):

  • Create fluorescent protein fusions of PHYPADRAFT_161913 and candidate interactors

  • Co-express in moss cells

  • Measure energy transfer using acceptor photobleaching or fluorescence lifetime imaging

Each method provides complementary information, with Co-IP identifying stable interactions and proximity labeling capturing more transient associations that may be functionally relevant.

How can CRISPR-Cas9 be optimized for studying PHYPADRAFT_161913 function in Physcomitrella patens?

CRISPR-Cas9 gene editing in Physcomitrella patens offers powerful approaches for studying PHYPADRAFT_161913 function. A comprehensive methodology involves:

• gRNA design and validation:

  • Select 3-4 target sites in the coding sequence using moss-specific CRISPR design tools

  • Avoid regions with secondary structures that might impede Cas9 binding

  • Check for off-target effects in the Physcomitrella genome

  • Validate gRNA efficiency using in vitro cleavage assays

• Homology-directed repair template construction:

  • Design with 800-1000bp homology arms flanking the target site

  • Incorporate reporter genes or epitope tags for functional studies

  • Consider silent mutations in the PAM site to prevent re-cutting

• Transformation protocol:

  • Prepare protoplasts from protonema tissue

  • Transform with Cas9, gRNA, and repair template using PEG-mediated transformation

  • Plate on selective media with appropriate antibiotics

  • Confirm integration via PCR and sequencing

• Phenotypic analysis pipeline:

  • Compare growth rates, developmental progression, and stress responses

  • Analyze cell wall composition and membrane organization

  • Evaluate transport functions using fluorescent tracers

  • Conduct transcriptomic and proteomic analyses to identify affected pathways

This approach allows for precise genetic manipulation to determine the role of PHYPADRAFT_161913 in moss development and cellular function, with exceptional efficiency due to the high rate of homologous recombination in Physcomitrella patens.

What strategies can be employed to investigate the evolutionary conservation of PHYPADRAFT_161913 function across plant lineages?

Investigating evolutionary conservation of PHYPADRAFT_161913 requires a multifaceted approach combining bioinformatics, structural biology, and functional complementation studies:

• Phylogenetic analysis protocol:

  • Identify homologs across plant lineages using BLAST and HMM searches

  • Align sequences using MUSCLE or MAFFT algorithms

  • Construct maximum likelihood trees with RAxML or IQ-TREE

  • Map key functional domains and determine conservation patterns

  • Calculate selection pressure (dN/dS ratios) to identify evolutionarily constrained regions

• Structural comparison methodology:

  • Generate structural models using AlphaFold2 or similar prediction tools

  • Compare predicted structures of homologs from different lineages

  • Identify conserved structural motifs potentially important for function

  • Analyze membrane-spanning regions and potential interaction interfaces

• Heterologous expression and complementation:

  • Clone PHYPADRAFT_161913 homologs from various plant species

  • Express in Physcomitrella patens PHYPADRAFT_161913 knockout lines

  • Assess rescue of mutant phenotypes

  • Quantify degree of functional complementation using standardized assays

• Domain swap experiments:

  • Create chimeric proteins exchanging domains between moss and other plant homologs

  • Express in knockout backgrounds

  • Determine which domains are functionally interchangeable

  • Identify lineage-specific adaptations in protein function

This comprehensive approach provides insights into the evolutionary history of CASP-like proteins and their functional diversification across plant evolution.

What methodologies are most effective for characterizing the role of PHYPADRAFT_161913 in abiotic stress responses?

To characterize the role of PHYPADRAFT_161913 in abiotic stress responses, researchers should implement a systematic experimental design:

• Stress induction protocol:

  • Expose wild-type and PHYPADRAFT_161913 mutant lines to:

    • Osmotic stress (mannitol, sorbitol, PEG)

    • Salt stress (NaCl, KCl)

    • Dehydration (controlled water deficit)

    • Temperature extremes (cold, heat)

    • Heavy metal exposure (Cd, Cu, Zn)

  • Monitor morphological changes, growth rates, and survival percentages

  • Standardize stress application methods for reproducibility

• Transcript and protein level analysis:

  • Quantify PHYPADRAFT_161913 expression changes using RT-qPCR

  • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

  • Normalize to multiple reference genes stable under stress conditions

  • Analyze protein abundance via Western blotting with specific antibodies

  • Compare transcript and protein dynamics to identify post-transcriptional regulation

• Cellular physiology measurements:

  • Membrane integrity (electrolyte leakage assay)

  • Reactive oxygen species (ROS) accumulation (DCFH-DA staining)

  • Lipid peroxidation (MDA content)

  • Antioxidant enzyme activities (SOD, CAT, APX)

  • Cell wall modifications (calcofluor white staining)

• Omics-based approach:

  • Transcriptomics: RNA-seq to identify differentially expressed genes

  • Proteomics: TMT-labeled quantitative proteomics

  • Metabolomics: GC-MS and LC-MS analyses of stress-responsive metabolites

  • Integrate datasets using systems biology approaches

This comprehensive methodology enables researchers to elucidate the specific contributions of PHYPADRAFT_161913 to stress adaptation mechanisms in Physcomitrella patens.

What are common challenges in purifying active PHYPADRAFT_161913 and how can they be addressed?

Researchers often encounter several challenges when purifying PHYPADRAFT_161913, particularly due to its membrane-associated nature. Effective troubleshooting approaches include:

Using a stepwise optimization approach, systematically modifying each parameter while maintaining others constant, can help identify the optimal conditions for obtaining functionally active PHYPADRAFT_161913 .

How can researchers differentiate between specific and non-specific effects when studying PHYPADRAFT_161913 function?

To establish causality and specificity in PHYPADRAFT_161913 functional studies, researchers should implement rigorous controls and validation approaches:

• Genetic validation strategy:

  • Generate multiple independent knockout or knockdown lines

  • Complement mutants with the wild-type gene to verify phenotype rescue

  • Use CRISPR-mediated precise editing to create specific mutations in functional domains

  • Compare phenotypes across different genetic manipulation approaches

• Biochemical specificity controls:

  • Include inactive protein controls (site-directed mutants in critical residues)

  • Use related but distinct CASP-family proteins as specificity controls

  • Perform dose-response experiments to establish relationship between protein level and phenotype

  • Conduct competition assays with unlabeled protein to confirm binding specificity

• Statistical analysis framework:

  • Determine appropriate sample sizes through power analysis

  • Use multiple biological and technical replicates

  • Apply appropriate statistical tests based on data distribution

  • Implement multiple comparison corrections (Bonferroni, FDR)

  • Set significance thresholds a priori

• Independent methodological validation:

  • Confirm key findings using orthogonal techniques

  • Verify interaction partners through reciprocal pulldowns

  • Validate functional effects in different experimental systems

  • Cross-reference results with published data on related proteins

This comprehensive approach minimizes false positives and increases confidence in the specificity of observed effects related to PHYPADRAFT_161913 function.

What analytical frameworks are most appropriate for interpreting complex phenotypic data from PHYPADRAFT_161913 studies?

Complex phenotypic data from PHYPADRAFT_161913 functional studies require sophisticated analytical approaches:

• Multivariate statistical analysis pipeline:

  • Principal Component Analysis (PCA) to identify major sources of variation

  • Hierarchical clustering to group similar phenotypes

  • Partial Least Squares Discriminant Analysis (PLS-DA) to identify discriminatory variables

  • ANOVA-Simultaneous Component Analysis (ASCA) for multifactorial experimental designs

• Machine learning implementation:

  • Random Forest algorithms to identify key phenotypic predictors

  • Support Vector Machines for phenotypic classification

  • Neural networks for pattern recognition in complex datasets

  • Decision tree models for interpretable phenotypic relationships

• Network-based analysis approach:

  • Construct protein-protein interaction networks centered on PHYPADRAFT_161913

  • Integrate transcriptomic data to build gene regulatory networks

  • Map phenotypic effects onto biological pathways

  • Identify network motifs associated with specific functional outcomes

• Quantitative image analysis methods:

  • Develop automated pipelines for morphological measurements

  • Implement object recognition algorithms for subcellular structure analysis

  • Quantify protein co-localization using Pearson's correlation and Manders' coefficients

  • Track dynamic processes through time-lapse imaging and particle tracking

These analytical frameworks transform complex, multidimensional data into interpretable biological insights, enabling more comprehensive understanding of PHYPADRAFT_161913 function in cellular and developmental contexts.

How might synthetic biology approaches be applied to engineer novel functions in PHYPADRAFT_161913?

Synthetic biology offers exciting opportunities to engineer PHYPADRAFT_161913 for novel functions and applications:

• Domain shuffling methodology:

  • Identify functional modules within the protein sequence

  • Create libraries of chimeric proteins combining domains from different CASP-family members

  • Screen for novel properties such as altered membrane localization or interaction specificity

  • Optimize chimeras through iterative design-build-test cycles

• Protein engineering strategy:

  • Implement computational design to modify substrate specificity

  • Introduce conditional regulation through light-responsive domains

  • Engineer split-protein complementation systems for studying protein-protein interactions

  • Create biosensors by coupling conformational changes to fluorescent reporters

• Orthogonal expression systems development:

  • Design synthetic promoters responsive to specific environmental stimuli

  • Create inducible expression systems for temporal control of PHYPADRAFT_161913 function

  • Develop tissue-specific expression systems for spatial regulation

  • Implement feedback loops for homeostatic control of protein levels

• Practical applications exploration:

  • Engineer stress-resistant plants through modified PHYPADRAFT_161913 function

  • Develop biosensors for environmental monitoring

  • Create synthetic cellular compartments with novel properties

  • Design biomaterials inspired by CASP protein structural properties

These approaches not only advance fundamental understanding but also leverage PHYPADRAFT_161913's unique properties for biotechnological applications.

What emerging technologies might revolutionize our understanding of PHYPADRAFT_161913 structural dynamics?

Several cutting-edge technologies are poised to transform our understanding of PHYPADRAFT_161913 structure and dynamics:

• Cryo-electron microscopy applications:

  • Single-particle analysis for high-resolution structure determination

  • Cryo-electron tomography to visualize the protein in its native membrane environment

  • Time-resolved cryo-EM to capture conformational intermediates

  • Correlative light and electron microscopy for in situ localization and structural analysis

• Advanced spectroscopy methodologies:

  • Single-molecule FRET to measure conformational dynamics

  • Nuclear magnetic resonance (NMR) for studying protein-lipid interactions

  • Electron paramagnetic resonance (EPR) with site-directed spin labeling to track domain movements

  • Mass photometry for analyzing protein complexes without labeling

• Computational simulation frameworks:

  • Molecular dynamics simulations in explicit membrane environments

  • Markov state models to characterize conformational landscapes

  • Enhanced sampling techniques to capture rare transitions

  • Machine learning approaches to predict dynamic behavior from structural data

• Super-resolution microscopy implementation:

  • PALM/STORM for nanoscale localization in living cells

  • Expansion microscopy for physical magnification of subcellular structures

  • Lattice light-sheet microscopy for rapid 3D imaging with reduced photodamage

  • Tracking of single molecules to map diffusion and interaction dynamics

These technologies will provide unprecedented insights into how PHYPADRAFT_161913 functions at the molecular level, especially regarding membrane association and protein-protein interactions.

How can systems biology approaches integrate PHYPADRAFT_161913 function into broader cellular networks?

Systems biology offers powerful frameworks for contextualizing PHYPADRAFT_161913 function within broader cellular networks:

• Multi-omics integration strategy:

  • Combine transcriptomics, proteomics, metabolomics, and phenomics data

  • Implement data integration algorithms (SNF, MOFA, DIABLO)

  • Develop Bayesian networks to infer causal relationships

  • Create genome-scale models incorporating PHYPADRAFT_161913 function

• Network analysis methodology:

  • Construct protein-protein interaction networks centered on PHYPADRAFT_161913

  • Perform network perturbation analysis using genetic and chemical interventions

  • Identify network motifs and regulatory circuits involving PHYPADRAFT_161913

  • Apply network medicine approaches to understand system-level effects

• Mathematical modeling framework:

  • Develop ordinary differential equation models of pathways involving PHYPADRAFT_161913

  • Implement stochastic modeling for processes with low molecule numbers

  • Create agent-based models for spatial aspects of protein function

  • Perform sensitivity analysis to identify critical parameters

• Evolutionary systems biology approach:

  • Compare network contexts of PHYPADRAFT_161913 homologs across species

  • Identify conserved and divergent network modules

  • Reconstruct ancestral network states

  • Model evolutionary trajectories of network architecture

These integrative approaches will provide a holistic understanding of how PHYPADRAFT_161913 contributes to cellular function beyond its immediate molecular interactions, revealing emergent properties and system-level roles.