Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_164940 (PHYPADRAFT_164940)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PHYPADRAFT_164940; CASP-like protein UU2; PpCASPLUU2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_164940
Target Protein Sequence
MEDPKGAWQSDVFDNGRDFKPHDKAPANVTAGTTPPMYNVGAGGSEGNSKALSIISIVLR CLSIMFNVVSLGVIASNQGKSYFVVWRTLNSSNMQYLFAINVIVLVYCVVQLILSIINLV QGKMVLSGPTQPASTITYICDQGLTYMLMAGFGAGVALQASVDKGESGMLDCSGANEFCG KNKASAALSFLGFVCIALSANLNYLRLYFMAAK
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PHYPADRAFT_164940 and what is its known function?

PHYPADRAFT_164940 is a CASP-like protein found in Physcomitrella patens subsp. patens, a non-vascular moss species. The protein consists of 213 amino acids and belongs to the family of CASP (Casparian strip membrane domain) proteins. While complete functional characterization is still ongoing, CASP-like proteins generally play crucial roles in membrane organization and barrier formation in plants. In P. patens, this protein may be involved in specialized membrane domain formation and regulation of cellular compartmentalization, though specific pathway associations are still being investigated through targeted knockout studies and localization experiments .

Why is Physcomitrella patens an advantageous expression system for recombinant proteins?

Physcomitrella patens offers multiple significant advantages as an expression system for recombinant proteins, particularly for research applications. Unlike many plant systems, P. patens enables protein production in cell suspension, providing a controlled environment similar to bacterial or mammalian cell culture systems. The most distinctive advantage is its exceptional capacity for homologous recombination, allowing precise genomic targeting and modification. This feature facilitates targeted knockout mutants for glycoengineering and quantitative optimization of protein production. Additionally, P. patens has emerged as one of the most advanced plant expression systems, offering an alternative to animal cell factories for producing therapeutic proteins with simple or complex structures .

What expression vectors are typically used for PHYPADRAFT_164940 production?

For recombinant expression of PHYPADRAFT_164940, researchers typically employ bacterial expression systems, particularly E. coli, using vectors containing a histidine tag for purification purposes. According to available product information, recombinant full-length PHYPADRAFT_164940 protein has been successfully produced with a His-tag in E. coli expression systems . When designing expression constructs, researchers should include appropriate targeting sequences flanking the coding region to facilitate homologous recombination if expression in P. patens itself is desired. For bacterial expression, pET-series vectors are commonly employed, while for expression in the native P. patens, vectors containing moss-specific promoters and selection markers are recommended for optimal protein production and targeting.

How can gene targeting approaches be optimized for studying PHYPADRAFT_164940 function?

Optimizing gene targeting for PHYPADRAFT_164940 functional studies requires understanding the underlying mechanisms of homologous recombination in Physcomitrella patens. P. patens exhibits particularly high frequencies of gene targeting when transformed with DNA constructs containing sequences homologous with genomic loci. Two primary integration mechanisms have been observed: Targeted Gene Replacement (TGR) resulting from homologous recombination between each end of a targeting construct and the targeted locus, and Targeted Insertion (TI), where integration occurs at one end by homologous recombination while the other end undergoes non-homologous end-joining (NHEJ) .

To maximize targeting efficiency for PHYPADRAFT_164940, consider these methodological approaches:

  • Design constructs with homology arms of at least 500-1000 bp flanking the target sequence

  • Employ multiple targeting vectors simultaneously for complex modifications

  • Include positive and negative selection markers to enrich for targeted integration events

  • Verify integration events using both PCR and Southern blot analysis to distinguish between TGR and TI events

  • Consider using CRISPR/Cas9 to enhance targeting efficiency by creating double-strand breaks at the target locus

Molecular analysis has shown that TI frequently occurs as a consequence of concatenation of the transforming DNA, which should be considered when designing targeting strategies .

What are the challenges in purifying functional PHYPADRAFT_164940 protein and how can they be addressed?

Purifying functional PHYPADRAFT_164940 presents several technical challenges that require specific methodological approaches. As a CASP-like protein potentially involved in membrane organization, PHYPADRAFT_164940 may have hydrophobic domains that complicate soluble expression and purification.

Key challenges and solutions include:

ChallengeMethodological Solution
Protein insolubilityUse mild detergents (0.1% DDM or 0.5% CHAPS) during lysis and purification
Maintaining native conformationInclude stabilizing agents like glycerol (10-15%) in buffers
Low expression yieldsOptimize induction conditions (temperature, IPTG concentration, duration)
Protein aggregationEmploy step-wise dialysis to remove detergents; test multiple buffer compositions
Purification interferenceUse tandem purification strategies (His-tag followed by size exclusion chromatography)

When expressing PHYPADRAFT_164940 with a His-tag in E. coli, researchers should consider testing multiple expression strains, particularly those designed for membrane or difficult-to-express proteins, such as C41(DE3) or C43(DE3) . Additionally, expression at lower temperatures (16-18°C) for extended periods often improves the yield of properly folded protein compared to standard conditions.

How does the glycosylation pattern of PHYPADRAFT_164940 expressed in P. patens compare to other expression systems?

The glycosylation pattern of recombinant proteins expressed in Physcomitrella patens represents a critical consideration for researchers studying PHYPADRAFT_164940. P. patens offers unique advantages for glycoengineering due to its sophisticated post-translational modification machinery that is more similar to human glycosylation patterns than bacterial or yeast systems.

When comparing PHYPADRAFT_164940 expression across systems, researchers should consider:

  • P. patens produces complex N-glycans with core α1,3-fucose and β1,2-xylose residues, which differ from mammalian patterns

  • Through targeted knockout of genes involved in plant-specific glycosylation, humanized glycoforms can be achieved in P. patens

  • Bacterial systems like E. coli lack glycosylation machinery entirely, producing non-glycosylated forms of the protein

  • Yeast systems typically produce hyperglycosylated proteins with mannose-rich structures

What are the optimal conditions for expressing recombinant PHYPADRAFT_164940 in E. coli?

Optimizing the expression of recombinant PHYPADRAFT_164940 in E. coli requires careful consideration of multiple parameters. Based on available information about this CASP-like protein and similar recombinant proteins, the following protocol is recommended:

  • Vector selection: pET-series vectors (particularly pET28a) with an N-terminal His-tag provide good results for CASP-like proteins

  • Expression strain: BL21(DE3) is suitable for initial trials, but Rosetta or Origami strains may improve expression of this plant protein

  • Induction conditions:

    • Culture temperature: 18°C after induction

    • IPTG concentration: 0.1-0.3 mM (higher concentrations may lead to inclusion body formation)

    • Induction duration: 16-20 hours at reduced temperature

For difficult-to-express membrane-associated proteins like CASP-family members, incorporating specific solubility-enhancing tags (such as SUMO or MBP) may significantly improve yield and solubility. Additionally, supplementing the growth medium with specific additives such as glucose (0.5-1%) to prevent leaky expression before induction can improve final protein quality .

The purification strategy should include immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, followed by size exclusion chromatography to ensure high purity and proper oligomeric state assessment.

What techniques are most effective for analyzing the localization and interaction partners of PHYPADRAFT_164940?

Multiple complementary techniques should be employed to comprehensively analyze PHYPADRAFT_164940 localization and interaction partners. Based on research approaches used for similar proteins, the following methodological workflow is recommended:

For subcellular localization:

  • Fluorescent protein fusion constructs (particularly C-terminal GFP fusions) for live-cell imaging in P. patens

  • Immunofluorescence microscopy using antibodies against the native protein or epitope tags

  • Subcellular fractionation followed by Western blot analysis to biochemically validate localization patterns

  • Electron microscopy with immunogold labeling for high-resolution localization studies

For interaction partner identification:

  • Co-immunoprecipitation (Co-IP) using antibodies against PHYPADRAFT_164940 or epitope tags

  • Yeast two-hybrid screening against a P. patens cDNA library

  • Proximity-dependent biotin identification (BioID) or proximity ligation assay (PLA)

  • Cross-linking followed by mass spectrometry (XL-MS)

When analyzing protein-protein interactions involving membrane-associated proteins like CASP-family members, techniques that preserve membrane integrity, such as membrane yeast two-hybrid systems or in situ approaches like fluorescence resonance energy transfer (FRET), may provide more physiologically relevant results than traditional pull-down approaches .

How can CRISPR/Cas9 be utilized for functional studies of PHYPADRAFT_164940?

CRISPR/Cas9 technology offers powerful approaches for functional characterization of PHYPADRAFT_164940 in Physcomitrella patens. The exceptional homologous recombination efficiency in P. patens can be further enhanced using CRISPR/Cas9-mediated double-strand breaks, enabling precise genomic modifications.

For PHYPADRAFT_164940 functional studies, consider the following CRISPR/Cas9 applications and methodological considerations:

  • Gene knockout:

    • Design guide RNAs targeting early exons (preferably exon 1) of PHYPADRAFT_164940

    • Include homology arms (500-1000bp) flanking a selection cassette for efficient integration

    • Screen transformants using PCR to identify complete gene replacement events

  • Protein tagging:

    • Design guide RNAs targeting the C-terminus of PHYPADRAFT_164940

    • Include homology arms containing the desired tag sequence (GFP, FLAG, etc.)

    • Verify in-frame integration using sequencing and expression by Western blot

  • Promoter replacement:

    • Target the region upstream of the PHYPADRAFT_164940 start codon

    • Include homology arms containing inducible or tissue-specific promoters

    • Validate altered expression patterns using qRT-PCR or reporter assays

  • Domain mutagenesis:

    • Design guide RNAs flanking specific functional domains

    • Provide repair templates containing desired mutations

    • Screen for precise editing using restriction enzyme digestion or sequencing

Given the efficiency of homologous recombination in P. patens, HDR-mediated repair will predominate over NHEJ-mediated repair, making precise editing highly feasible. Multiple guide RNAs can be used simultaneously for complex modifications or for studying potential functional redundancy with related CASP-like proteins .

How should phenotypic data from PHYPADRAFT_164940 knockout studies be interpreted?

Interpreting phenotypic data from PHYPADRAFT_164940 knockout studies requires careful consideration of multiple factors related to CASP-like protein function in Physcomitrella patens. CASP proteins typically function in specialized membrane domains, and phenotypic effects may be subtle or context-dependent.

When analyzing knockout phenotypes, consider these methodological approaches:

  • Conduct comprehensive phenotypic characterization across multiple developmental stages and under various environmental conditions, as CASP-like protein functions may be stress-responsive or development-specific

  • Employ high-resolution imaging techniques to detect potential ultrastructural changes in cellular membranes or compartmentalization that may not be apparent at the macroscopic level

  • Implement quantitative growth assays measuring parameters such as colony diameter, gametophore development, and protonema extension rates

  • Assess membrane integrity and barrier function using tracer compounds or electrophysiological measurements

  • Compare phenotypes to known membrane organization mutants to identify potential functional relationships

If knockout studies yield limited phenotypic effects, consider the possibility of functional redundancy with other CASP-family members. In such cases, generating multiple gene knockouts or employing conditional expression systems may reveal functions masked by compensatory mechanisms. Additionally, environmental challenges (osmotic stress, nutrient limitation, pH changes) may unveil condition-specific requirements for PHYPADRAFT_164940 function .

What are the key considerations when comparing PHYPADRAFT_164940 sequence and structure to other CASP-like proteins?

When performing comparative analyses of PHYPADRAFT_164940 with other CASP-like proteins, researchers should account for several key methodological considerations to generate meaningful insights:

  • Sequence alignment approaches:

    • Employ profile-based methods (PSI-BLAST, HMMER) rather than simple pairwise alignments to detect distant relationships

    • Include sequences from diverse plant lineages (bryophytes, lycophytes, angiosperms) to trace evolutionary patterns

    • Focus particularly on the CASP domain and transmembrane regions, which are likely to be more conserved than terminal regions

  • Structural prediction considerations:

    • Utilize multiple prediction algorithms (AlphaFold2, RoseTTAFold, I-TASSER) and compare outputs

    • Pay special attention to predicted membrane topology and orientation

    • Validate predictions with experimental approaches like limited proteolysis or cysteine accessibility

  • Functional domain analysis:

    • Map conserved motifs to known functional regions in better-characterized CASP proteins

    • Identify moss-specific sequence features that may relate to the unique biology of Physcomitrella

    • Consider coevolution analysis to identify potentially interacting residues

  • Phylogenetic analysis:

    • Use appropriate evolutionary models for membrane proteins (e.g., LG+F+G4)

    • Implement both Maximum Likelihood and Bayesian inference methods

    • Perform bootstrap analysis with at least 1000 replicates to assess node confidence

How reliable are computational predictions of post-translational modifications for PHYPADRAFT_164940?

The reliability of computational predictions for post-translational modifications (PTMs) of PHYPADRAFT_164940 requires critical evaluation through multiple methodological lenses. When assessing PTM predictions for this CASP-like protein, researchers should consider:

  • Prediction sensitivity and specificity:

    • N-glycosylation predictions (using NetNGlyc, GlycoEP) are generally reliable for identifying potential sites (NXS/T motifs) but cannot confirm occupancy

    • Phosphorylation predictions (using NetPhos, PhosphoSite) exhibit higher false positive rates and should be interpreted cautiously

    • SUMOylation and ubiquitination predictions typically have moderate accuracy and require experimental validation

  • Evolutionary conservation of predicted sites:

    • PTM sites conserved across multiple plant CASP proteins have higher confidence

    • Sites that show lineage-specific conservation patterns may indicate specialized functions

    • Non-conserved sites with high prediction scores warrant careful experimental assessment

  • Structural context evaluation:

    • Predicted PTM sites should be evaluated in the context of protein structure models

    • Sites buried within transmembrane domains are less likely to be modified despite positive predictions

    • Surface-exposed residues in cytoplasmic or extracellular domains represent more plausible targets

  • Integration of multiple prediction tools:

    • Consensus approaches using multiple algorithms significantly improve prediction accuracy

    • Tool selection should account for training set biases (many tools are trained primarily on mammalian data)

    • Tools specifically trained on plant datasets (PlantPhos, etc.) should be prioritized

To overcome the limitations of computational predictions, researchers should validate key predicted PTMs using targeted experimental approaches such as site-directed mutagenesis of predicted modification sites followed by functional assays, or mass spectrometry analysis of the purified recombinant protein .

What are common pitfalls in PHYPADRAFT_164940 recombinant expression and how can they be avoided?

Recombinant expression of PHYPADRAFT_164940 presents several technical challenges common to membrane-associated and plant-derived proteins. Researchers should be aware of these potential pitfalls and implement appropriate mitigation strategies:

Common PitfallUnderlying CauseMitigation Strategy
Poor solubilityHydrophobic domains typical of CASP-like proteinsTest multiple detergents (DDM, CHAPS, Triton X-100); use solubility-enhancing tags (SUMO, MBP); express at lower temperatures (16-18°C)
Proteolytic degradationInstability in heterologous expression systemAdd protease inhibitors during purification; optimize extraction buffers; use protease-deficient expression strains
Low expression levelsCodon bias between moss and expression hostOptimize codon usage for expression host; use Rosetta strains for E. coli expression; test multiple expression vectors
Improper foldingDifferences in chaperone systems between speciesCo-express with molecular chaperones; include folding enhancers (glycerol, arginine) in buffers; test periplasmic expression
Aggregation during purificationExposure of hydrophobic regionsMaintain detergent above critical micelle concentration throughout purification; include stabilizing agents; avoid freeze-thaw cycles

For E. coli expression systems, optimizing induction parameters is particularly critical. Extended expression times (18-24 hours) at reduced temperatures (16-18°C) often yield better results than standard conditions. Additionally, inclusion of specific additives like 5% glycerol and 0.1% glucose in the culture medium can improve protein solubility and stability .

How can gene targeting efficiency be improved when working with PHYPADRAFT_164940 in P. patens?

Improving gene targeting efficiency for PHYPADRAFT_164940 modifications in Physcomitrella patens requires optimizing several key parameters of the transformation and homologous recombination process. Based on research with this model system, implement these methodological strategies:

  • Targeting construct design:

    • Include homology arms of 500-1000bp flanking the target region for optimal recombination frequency

    • Ensure homology arm sequences are identical to the target locus (verify by sequencing if working with different P. patens strains)

    • Position selectable markers to facilitate easy screening of integration events

    • Linearize constructs before transformation to enhance integration efficiency

  • Transformation optimization:

    • Use protoplasts in early regeneration stages for highest transformation efficiency

    • Optimize PEG concentration and transformation duration based on protoplast viability

    • Include a recovery period in liquid medium before selection

    • Apply sequential selection rather than immediate strong selection

  • Enhanced targeting approaches:

    • Employ CRISPR/Cas9 to create double-strand breaks at the target locus

    • Consider temporary suppression of NHEJ machinery during transformation

    • Use negative selection markers to counter random integration events

    • Implement temperature optimization during selection (lower temperatures often improve targeting)

  • Screening strategies:

    • Design PCR primers spanning integration junctions to distinguish between TGR and TI events

    • Implement nested PCR approaches for greater sensitivity in detecting correct integration

    • Use Southern blotting to verify copy number and integration pattern

    • Consider whole-genome sequencing for complex modifications or to verify clean integration

Molecular analysis has demonstrated that both targeted gene replacement (TGR) and targeted insertion (TI) occur frequently in P. patens, with the latter resulting from concatenation of transforming DNA. Understanding these mechanisms can help researchers design more effective targeting strategies and screening approaches .

What controls should be included when studying PHYPADRAFT_164940 protein-protein interactions?

When investigating protein-protein interactions involving PHYPADRAFT_164940, rigorous experimental controls are essential to ensure reliable and reproducible results. The following comprehensive set of controls should be implemented based on the interaction detection method employed:

For co-immunoprecipitation (Co-IP) experiments:

  • Input control: Analysis of lysate before immunoprecipitation to confirm protein expression

  • Negative antibody control: Use of non-specific IgG of the same species as the primary antibody

  • Bait-free control: Parallel processing of cells not expressing tagged PHYPADRAFT_164940

  • RNase/DNase treatment controls: To exclude nucleic acid-mediated interactions

  • Detergent stringency controls: Multiple wash conditions to distinguish stable from transient interactions

For yeast two-hybrid assays:

  • Autoactivation control: Test bait construct alone for reporter activation

  • Positive interaction control: Known interaction pair from P. patens

  • Negative interaction control: Unrelated protein pairs

  • Expression verification: Western blots confirming expression of bait and prey fusions

  • Reverse configuration test: Swap bait and prey domains to verify interactions

For proximity labeling approaches (BioID/TurboID):

  • Catalytically inactive enzyme control: Mutation in the biotin ligase

  • Localization-matched control: Different protein with similar subcellular distribution

  • Temporal controls: Multiple labeling durations to distinguish proximity from interaction

  • Competitive controls: Addition of excess free biotin to block specific labeling

For all interaction studies:

  • Biological replicates: Minimum three independent experiments

  • Technical replicates: Multiple samples within each experiment

  • Reciprocal validation: Confirmation using complementary interaction detection methods

  • Domain mapping: Truncation constructs to identify specific interaction domains

  • Functional validation: Phenotypic analysis of interaction-disrupting mutations

These methodological controls help distinguish genuine interactions from experimental artifacts, particularly important for membrane-associated proteins like CASP-family members that may form non-specific associations during solubilization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.