Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_182225 (PHYPADRAFT_182225)

Shipped with Ice Packs
In Stock

Description

Functional and Evolutionary Context

PHYPADRAFT_182225 belongs to the CASPL protein family, which plays roles in membrane domain organization and cell wall modification in plants. Key findings include:

Role in Membrane Scaffolding

CASPL proteins, including PHYPADRAFT_182225, share structural similarities with MARVEL domain proteins, which stabilize membrane domains through transmembrane helices . These scaffolds are hypothesized to recruit enzymes for lignin polymerization, a process critical for Casparian strip formation in root endodermis .

Phylogenetic Distribution

  • Plant-Specific Conservation: CASPLs are present in all major land plant lineages and green algae but are absent in Physcomitrella patens for some homologs with specific extracellular loop signatures .

  • MARVEL Domain Homology: CASPLs share transmembrane domain similarity with MARVEL proteins (e.g., conserved basic and acidic residues in transmembrane helices), suggesting evolutionary convergence in membrane organization .

Recombinant Production in Physcomitrella patens

The moss Physcomitrella patens is a model organism for recombinant protein production due to its efficient homologous recombination and scalable bioreactor systems . While PHYPADRAFT_182225 is expressed in E. coli in this case, P. patens’ advantages include:

AdvantageApplication
Precision Genome EditingTargeted knockout mutants for glycoengineering or protein optimization
Scalable ProductionUp to 500 L wave reactors for large-scale protein synthesis
Protein StabilityConsistent batch-to-batch stability in bioreactors

Membrane Biology Studies

PHYPADRAFT_182225’s recombinant form enables structural studies of transmembrane scaffolds. For example:

  • Localization Assays: Ectopic expression in tobacco or Arabidopsis could test its ability to integrate into Casparian strip domains .

  • Mutagenesis: Site-directed mutagenesis of conserved residues (e.g., W164G in CASP1 ) could reveal functional motifs.

Cold Stress and Growth Regulation

While PHYPADRAFT_182225 has not been directly linked to cold tolerance, related CASPLs (e.g., ClCASPL in watermelon) regulate growth and cold responses by modulating lignin deposition and membrane stability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us and we will prioritize the development of your specified tag.
Synonyms
PHYPADRAFT_182225; CASP-like protein 4C2; PpCASPL4C2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_182225
Target Protein Sequence
MEAADSATNNSKDTHFYGKSRAENRRRSDAMLLLFRALTFSFSLAAVVVMGTNRYRINPQ LKVSWYDFEPYRYVLAVNAIICIYSFVETWLAVYTYLQGSYLLPEIFQVWFDYGHDQGFA YLLFSANSAGVAMAQLLQSGNTLIHGAYHCTEAGGYCTQARVSIALGFVAFLFLALSSLL TGLRVARWYLR
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PHYPADRAFT_182225 and what is its role in Physcomitrella patens?

PHYPADRAFT_182225 is a CASP-like protein identified in the moss Physcomitrella patens subsp. patens. It belongs to the Casparian strip membrane domain protein (CASP) family, which is critical for the formation of Casparian strips in plant endodermal cells. The full-length protein consists of 191 amino acids and plays a crucial role in the plant's response to environmental stresses . Similar to other CASP proteins, PHYPADRAFT_182225 likely contributes to establishing selective barriers in specific cellular domains, facilitating controlled nutrient uptake and transport within the plant. In moss species like Physcomitrella patens, these proteins help maintain cellular integrity under varying environmental conditions, making them essential for plant survival and adaptation.

What expression patterns does PHYPADRAFT_182225 exhibit in Physcomitrella patens?

While specific expression data for PHYPADRAFT_182225 is not directly provided in the available literature, studies on related CASP proteins offer valuable insights into its likely expression patterns. In both rice and Arabidopsis, the majority of CASP genes show high expression in root tissues, particularly in endodermal cells . By extrapolation, PHYPADRAFT_182225 would likely exhibit similar tissue-specific expression in Physcomitrella patens, with potential enrichment in tissues that require specialized membrane barriers. Research on CASP family members indicates that many contain MYB binding motifs in their promoter regions, suggesting responsiveness to specific transcription factors . Additionally, expression patterns may be dynamic, responding to environmental cues such as light conditions, as observed with other genes in Physcomitrella patens that show light-responsive regulation through mechanisms involving histone modifications .

What experimental design considerations are critical when studying PHYPADRAFT_182225 function?

When designing experiments to investigate PHYPADRAFT_182225 function, researchers must implement rigorous methodological controls to ensure valid results. Randomization is essential when allocating experimental units to different treatment groups to minimize selection bias, yet studies show that 87% of publications fail to report randomization procedures . For qualitative assessments of PHYPADRAFT_182225 function or localization, blinding should be employed to prevent observer bias—a practice reported in only 14% of studies using qualitative scoring .

When studying PHYPADRAFT_182225 responses to multiple experimental variables (e.g., light conditions, nutrient availability, and temperature), factorial designs should be considered as they allow researchers to evaluate interaction effects efficiently while potentially reducing the total number of experimental units. Notably, only 62% of studies amenable to factorial design actually implemented this approach, indicating missed opportunities for experimental efficiency .

Table 1: Key Experimental Design Elements for PHYPADRAFT_182225 Research

Design ElementPurposeImplementation Strategy
RandomizationReduces selection biasUse systematic physical approach (e.g., random number generators)
BlindingMinimizes observer biasEnsure researchers assessing outcomes are unaware of treatment assignments
Factorial DesignTests multiple variables efficientlyCombine factors (e.g., light, temperature, genotype) in single experiment
Positive/Negative ControlsValidates experimental systemInclude known CASP proteins and non-CASP controls
Biological ReplicatesAccounts for biological variationMinimum 3-5 independent biological replicates

How does light regulation affect PHYPADRAFT_182225 expression and what mechanisms are involved?

Light regulation likely affects PHYPADRAFT_182225 expression through complex mechanisms involving chromatin modifications. Studies in Physcomitrella patens have demonstrated that histone 3 lysine 36 trimethylation (H3K36me3) rapidly responds to red light exposure at specific gene loci, and this modification inversely correlates with intron retention events in transcript processing . While PHYPADRAFT_182225 was not specifically identified in this study, the underlying mechanisms may apply to its regulation.

The chromatin adaptor protein PpMRG1 (Physcomitrella patens MORF-related gene 1) has been shown to associate with H3K36me3 marks upon red light exposure, with this interaction occurring differentially across various gene loci . This light-dependent chromatin interaction affects alternative splicing patterns, which could potentially influence PHYPADRAFT_182225 expression or transcript processing. Researchers investigating PHYPADRAFT_182225 light response should consider examining both transcriptional regulation and post-transcriptional modifications, as alternative splicing represents a rapid adaptive mechanism in response to environmental stimuli.

To effectively study light-mediated regulation of PHYPADRAFT_182225, experiments should include:

  • Exposure to different light wavelengths (red, blue, far-red)

  • Time-course analysis of expression and splicing patterns

  • ChIP-seq analysis of histone modifications at the PHYPADRAFT_182225 locus

  • Analysis of splicing factors that might interact with the PHYPADRAFT_182225 pre-mRNA

What methodologies are most effective for analyzing PHYPADRAFT_182225 protein-protein interactions?

The analysis of PHYPADRAFT_182225 protein-protein interactions requires a multi-faceted approach combining in vitro and in vivo techniques. Based on studies of related CASP proteins, PHYPADRAFT_182225 likely functions within a complex protein network in specialized membrane domains . Effective methodologies should address both binary interactions and complex formation.

To identify components of larger protein complexes containing PHYPADRAFT_182225, immunoprecipitation followed by mass spectrometry (IP-MS) represents a powerful approach. For this technique, the availability of specific antibodies against PHYPADRAFT_182225 is crucial, or alternatively, transgenic lines expressing tagged versions of the protein can be utilized. When designing tagged versions, researchers should carefully consider the position of the tag to avoid disrupting protein function or localization.

Table 2: Methodologies for PHYPADRAFT_182225 Protein Interaction Studies

MethodologyAdvantagesLimitationsRecommendations
Membrane Y2HSuited for membrane proteins, high-throughputArtificial system, potential false positivesUse as initial screening tool
Co-immunoprecipitationDetects interactions in native contextRequires specific antibodies or protein tagsCombine with mass spectrometry for complex identification
BiFCVisualizes interactions in live cellsIrreversible complex formationCareful control of expression levels
FRETDetects dynamic interactions, quantifiableTechnically challengingIdeal for studying interaction dynamics
Proximity labeling (BioID)Identifies transient interactionsMay label proximal non-interacting proteinsUseful for membrane domain organization

What are the optimal conditions for expressing recombinant PHYPADRAFT_182225 in E. coli?

Expression of recombinant PHYPADRAFT_182225 in E. coli requires optimization of several parameters to enhance protein yield and solubility. According to available information, PHYPADRAFT_182225 is successfully expressed as a full-length His-tagged protein in E. coli . For optimal expression, researchers should consider the following parameters:

Expression strain selection: BL21(DE3) and its derivatives are commonly used for recombinant protein expression. For membrane-associated proteins like PHYPADRAFT_182225, strains such as C41(DE3) or C43(DE3), which are engineered to better tolerate membrane protein expression, may improve yields. Additionally, strains containing extra copies of rare tRNAs (e.g., Rosetta) may enhance expression if the PHYPADRAFT_182225 sequence contains codons rarely used in E. coli.

Induction conditions: For CASP-like proteins, lower induction temperatures (16-20°C) often improve protein folding and solubility. IPTG concentration should be optimized, typically starting with 0.1-0.5 mM, and induction should proceed for 16-20 hours at reduced temperature. Alternatively, auto-induction media can provide gentler expression conditions that may enhance proper folding.

Solubilization strategies: As a membrane-associated protein, PHYPADRAFT_182225 may form inclusion bodies or require detergents for solubilization. A panel of detergents (e.g., DDM, LDAO, or milder non-ionic detergents) should be screened for optimal extraction. If inclusion bodies form, refolding protocols using gradually decreasing concentrations of denaturants may be necessary.

Fusion tags: While His-tags are commonly used for purification , fusion partners such as MBP (maltose-binding protein) or SUMO can enhance solubility. Careful consideration of tag position (N- or C-terminal) is important, as it may affect protein folding and function.

How can researchers effectively analyze the evolutionary relationships of PHYPADRAFT_182225 within the CASP protein family?

Analyzing the evolutionary relationships of PHYPADRAFT_182225 within the CASP protein family requires a comprehensive comparative genomics approach. Research on CASP proteins in rice and Arabidopsis has already established a framework for such analysis, revealing six distinct subgroups and highlighting the importance of whole genome duplication (WGD) and tandem duplication (TD) events in CASP evolution .

To effectively position PHYPADRAFT_182225 within this evolutionary context, researchers should implement the following methodological steps:

Sequence collection and alignment: Comprehensive collection of CASP protein sequences from diverse plant species, including bryophytes, lycophytes, gymnosperms, and angiosperms. Multiple sequence alignment should be performed using programs like MUSCLE or MAFFT, with careful attention to conserved domains and motifs.

Phylogenetic analysis: Construction of phylogenetic trees using both maximum likelihood (e.g., RAxML, IQ-TREE) and Bayesian inference (e.g., MrBayes) methods. Support values should be assessed through bootstrap analysis (typically 1000 replicates) or posterior probabilities. The resulting phylogeny will help place PHYPADRAFT_182225 within the broader CASP family context.

Ancestral state reconstruction: Inference of ancestral CASP protein sequences at key phylogenetic nodes to understand the trajectory of functional evolution. This approach can help identify critical amino acid changes that may have contributed to functional diversification of PHYPADRAFT_182225.

What protocols are recommended for studying PHYPADRAFT_182225 localization and function in Physcomitrella patens?

Studying PHYPADRAFT_182225 localization and function in Physcomitrella patens requires specialized protocols that take advantage of the model system's unique features. Physcomitrella patens offers exceptional advantages for functional genomics due to its high rate of homologous recombination, allowing precise gene targeting approaches.

Subcellular localization analysis:
To determine the precise subcellular localization of PHYPADRAFT_182225, fluorescent protein fusion constructs should be generated. Both C- and N-terminal fusions should be tested, as tag position may affect localization or function. For transient expression, PEG-mediated protoplast transformation offers a rapid approach, while stable transformation allows observation in intact tissues. Confocal microscopy combined with co-localization studies using established organelle markers will enable precise determination of PHYPADRAFT_182225 distribution. Based on knowledge of other CASP proteins, particular attention should be paid to plasma membrane domains and potential association with specialized membrane structures.

Functional characterization through gene targeting:
Physcomitrella patens allows efficient generation of knockout, knockdown, and knock-in mutants through homologous recombination. For PHYPADRAFT_182225 functional analysis, the following approaches are recommended:

  • Gene knockout using homologous recombination to replace the gene with a selection marker

  • CRISPR/Cas9-mediated mutagenesis for generating precise mutations

  • RNAi-mediated knockdown for genes where complete knockout may be lethal

  • Promoter-reporter fusions to study expression patterns in different tissues and developmental stages

Phenotypic analysis:
Based on the known functions of CASP proteins in vascular plants, phenotypic analysis of PHYPADRAFT_182225 mutants should focus on:

  • Barrier functions in specialized tissues

  • Response to environmental stresses, particularly ionic stresses

  • Nutrient uptake and transport efficiency

  • Cellular structure integrity, especially in tissues with specialized membrane domains

  • Light responses, given the evidence for light-regulated gene expression in Physcomitrella patens

Complementation studies:
To confirm phenotypes observed in mutants are specifically due to PHYPADRAFT_182225 disruption, complementation with the wild-type gene is essential. Additionally, complementation with CASP genes from other species can provide insights into functional conservation and evolution.

How should researchers design experiments to study PHYPADRAFT_182225 response to environmental stresses?

Designing robust experiments to study PHYPADRAFT_182225 response to environmental stresses requires careful consideration of experimental variables, controls, and analytical approaches. Given that CASP proteins play crucial roles in plant responses to environmental stresses , a systematic experimental design is essential.

The experimental design should incorporate randomization to eliminate selection bias, with experimental units (e.g., moss colonies) randomly assigned to treatment groups . For qualitative assessments, blinding procedures should be implemented to prevent observer bias, particularly when scoring phenotypic responses . When multiple stress factors are being investigated (e.g., drought, salinity, temperature), factorial designs should be employed to efficiently test interaction effects .

Recommended experimental workflow:

  • Preliminary stress response characterization:

    • Expose wild-type Physcomitrella patens to gradient levels of different stresses

    • Monitor PHYPADRAFT_182225 expression using RT-qPCR or RNA-seq

    • Determine stress levels that induce significant expression changes

  • Comparative analysis of wild-type and mutant responses:

    • Generate PHYPADRAFT_182225 knockout/knockdown lines

    • Subject both wild-type and mutant lines to optimized stress conditions

    • Analyze physiological parameters (growth, chlorophyll content, membrane integrity)

    • Measure biochemical markers (reactive oxygen species, stress hormones)

  • Molecular response profiling:

    • Perform transcriptome analysis to identify differentially expressed genes

    • Conduct proteomics to detect changes in protein abundance and modifications

    • Analyze metabolite profiles to identify altered metabolic pathways

Table 3: Environmental Stress Experimental Design for PHYPADRAFT_182225 Research

Stress TypeTreatment LevelsDurationKey Parameters to MeasureControls
Osmotic0, 100, 200, 300 mM mannitol24h, 48h, 7dWater content, proline, PHYPADRAFT_182225 expressionUnstressed, osmotic-tolerant genotype
Ionic0, 50, 100, 150 mM NaCl24h, 48h, 7dIon content, membrane integrity, ROS levelsUnstressed, salt-tolerant genotype
Temperature4°C, 20°C, 30°C6h, 24h, 48hHSP expression, photosynthetic efficiency, membrane fluidityOptimal temperature (20-22°C)
Light stressDark, low, medium, high intensity1h, 6h, 24hPhotosynthetic parameters, H3K36me3 levels, splicing patternsStandard growth light conditions

What bioinformatics approaches are most useful for analyzing PHYPADRAFT_182225 structure-function relationships?

Understanding the structure-function relationships of PHYPADRAFT_182225 requires sophisticated bioinformatics approaches that integrate sequence analysis, structural prediction, and comparative genomics. As a CASP-like protein, PHYPADRAFT_182225 likely contains conserved domains and motifs that are critical for its function in membrane organization and barrier formation.

Sequence-based analysis:
Detailed sequence analysis should begin with identification of conserved domains, motifs, and transmembrane regions using tools such as Pfam, SMART, and TMHMM. Multiple sequence alignment with other CASP family proteins, particularly those with characterized functions, can highlight conserved residues that may be functionally important. Conservation analysis using methods like ConSurf can map evolutionary conservation onto structural models to identify functional hotspots.

Structural prediction and analysis:
In the absence of experimental structures, computational prediction methods provide valuable insights into PHYPADRAFT_182225 structure. Modern protein structure prediction tools like AlphaFold2 or RoseTTAFold can generate high-confidence structural models. These models can be refined using molecular dynamics simulations to assess structural stability and conformational dynamics. Analysis of surface properties, including electrostatic potential and hydrophobicity, can help identify potential interaction interfaces or membrane-association regions.

Molecular docking and interaction prediction:
To predict potential protein-protein interactions, molecular docking approaches can be applied to PHYPADRAFT_182225 structural models and candidate interacting partners. Coevolution analysis methods like Direct Coupling Analysis (DCA) can identify residue pairs that may be involved in interactions based on coordinated evolutionary changes.

Integration with experimental data:
Bioinformatics predictions should be integrated with experimental data whenever possible. For instance, observed phenotypes in mutants can be mapped to specific structural features or domains, and expression patterns can be correlated with the presence of particular regulatory elements.

Recommended bioinformatics workflow:

  • Comprehensive sequence analysis and domain identification

  • High-quality structural modeling using AlphaFold2 or similar tools

  • Molecular dynamics simulations to assess structural dynamics

  • Identification of potential functional sites through conservation analysis

  • Prediction of protein-protein interactions through docking and coevolution analysis

  • Integration of predictions with experimental data for validation

How can researchers effectively address data inconsistencies in PHYPADRAFT_182225 functional studies?

Addressing data inconsistencies in PHYPADRAFT_182225 functional studies requires a systematic approach to identify sources of variation and implement strategies to enhance reproducibility. Inconsistencies may arise from biological variability, technical limitations, or experimental design flaws.

Common sources of inconsistency in PHYPADRAFT_182225 studies:

  • Developmental stage variation: CASP protein expression and function may vary significantly depending on the developmental stage of Physcomitrella patens. Inconsistencies can arise when comparing results from different developmental contexts.

  • Environmental conditions: Light conditions, temperature, and media composition can affect gene expression and protein function. Subtle differences in these parameters between laboratories may lead to contradictory results.

  • Genetic background effects: Even in model organisms like Physcomitrella patens, genetic background variations can influence experimental outcomes, particularly for proteins involved in stress responses.

  • Technical variation in protein expression and purification: For recombinant protein studies, differences in expression systems, purification methods, and protein handling can affect protein activity and interaction properties.

Strategies to address inconsistencies:

What are the most promising research directions for understanding PHYPADRAFT_182225 function in non-vascular plants?

Understanding PHYPADRAFT_182225 function in non-vascular plants represents an exciting frontier in plant biology research. Based on current knowledge of CASP proteins and the unique biology of Physcomitrella patens, several promising research directions emerge.

The evolutionary significance of PHYPADRAFT_182225 in non-vascular plants deserves particular attention. While CASP proteins in vascular plants are well-characterized for their role in Casparian strip formation in the endodermis , their function in bryophytes like Physcomitrella patens, which lack true vascular tissues, remains intriguing. Comparative functional studies between PHYPADRAFT_182225 and CASP proteins from vascular plants could reveal how these proteins were repurposed during plant evolution to accommodate increasingly complex tissue organization.

The potential role of PHYPADRAFT_182225 in light signaling pathways also presents an exciting research direction. Studies in Physcomitrella patens have demonstrated sophisticated light-responsive gene regulation mechanisms involving histone modifications and alternative splicing . Investigating whether PHYPADRAFT_182225 participates in or is regulated by these pathways could reveal novel aspects of light adaptation in non-vascular plants.

Additionally, the involvement of PHYPADRAFT_182225 in stress response mechanisms merits detailed investigation. Given that CASP proteins play crucial roles in stress adaptation in vascular plants , determining how PHYPADRAFT_182225 contributes to stress resilience in Physcomitrella patens could provide insights into fundamental aspects of plant stress biology and potentially identify conserved mechanisms that could be targeted for improving crop resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.