Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_192523 (PHYPADRAFT_192523)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

The protein is produced recombinantly in Escherichia coli systems for research applications. Key production details include:

ParameterSpecification
Expression HostE. coli
TagN-terminal His tag for purification
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C; repeated freeze-thaw cycles are not recommended
PurityOptimized for research-grade applications (exact purity metrics not provided)

Evolutionary Context

PHYPADRAFT_192523 belongs to CASPL group 4C3, a subfamily conserved across bryophytes (e.g., mosses) and vascular plants. CASPLs share ancestral homology with MARVEL proteins, which mediate membrane organization in eukaryotes .

Research Applications

PHYPADRAFT_192523 is commercially available for ELISA and protein interaction studies. Notable applications include:

  • Structural Analysis: Investigating transmembrane domain dynamics .

  • Comparative Genomics: Studying CASPL evolution in basal land plants vs. flowering plants .

  • Biochemical Assays: Testing interactions with lignin synthesis enzymes or stress-response pathways .

Limitations and Future Directions

Current knowledge gaps include:

  • Direct Functional Data: No in vivo studies confirm its role in Physcomitrella patens Casparian strip formation.

  • Stress Response Links: While related CASPs respond to abiotic stresses, PHYPADRAFT_192523’s involvement remains unvalidated .

Future research could leverage Physcomitrella patens’s tractable genome for targeted gene disruption studies to elucidate this protein’s biological roles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PHYPADRAFT_192523; CASP-like protein 4C3; PpCASPL4C3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_192523
Target Protein Sequence
METGDSAVKSSQDVHYYGKSTAQKHRRSNGIILIFRALTFSFSLTSVIVMGTNRHRIDAQ SRVAWYDFDPFRYVLAVNAIICIYSFVEIWLAVYTYLKDTLFLPETFQVWFDYGHDQGFA YLLFSANSAGIAMAQLLQSGNSLIHGAYRCSDAGVFCTQARASIGLGFGAFLFLALSSLL TGLRVARWYFS
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PHYPADRAFT_192523 and how does it relate to vascular plant CASP proteins?

PHYPADRAFT_192523 is a CASP-like protein identified in the moss Physcomitrella patens. While vascular plants utilize CASP proteins for forming Casparian strips in the endodermis, the presence of CASP-like proteins in non-vascular plants like P. patens suggests evolutionary conservation of cell wall modification mechanisms. The protein likely participates in specialized cell wall formation processes, though its precise function differs from vascular plant counterparts due to the absence of true endodermal tissue in mosses .

Methodologically, researchers can investigate this relationship through:

  • Sequence alignment and phylogenetic analysis with known CASP proteins

  • Domain structure comparison using protein modeling tools

  • Complementation studies in vascular plant casp mutants

  • Localization studies to determine if PHYPADRAFT_192523 associates with specialized membrane domains

What expression systems are most effective for PHYPADRAFT_192523 research?

Two primary expression systems have demonstrated effectiveness for PHYPADRAFT_192523 research:

  • E. coli expression system: Currently used for producing recombinant PHYPADRAFT_192523 with His-tag for purification and functional studies . This system allows for high protein yields but may lack plant-specific post-translational modifications.

  • P. patens native expression system: Offers significant advantages due to the moss's efficient homologous recombination capabilities, allowing for targeted gene manipulation. This system enables protein production in cell suspension cultures with proper plant-specific modifications .

For methodological implementation, researchers should:

  • Use codon-optimized sequences for the chosen expression system

  • Employ inducible promoters for controlled expression

  • Include appropriate purification tags (His-tag for E. coli systems)

  • Consider temperature and inducer concentration optimization for yield improvement

What methods can effectively detect PHYPADRAFT_192523 expression and localization?

Multiple complementary techniques can be employed to study PHYPADRAFT_192523 expression and localization:

  • Fluorescent protein fusion: Similar to CASP1-GFP approaches used in Arabidopsis studies, PHYPADRAFT_192523 can be tagged with fluorescent proteins to visualize its dynamic localization in living cells .

  • Immunolocalization: Using specific antibodies against PHYPADRAFT_192523 allows precise cellular and subcellular localization studies in fixed tissues.

  • Transcript analysis: RT-qPCR and RNA-seq approaches can determine spatial and temporal expression patterns of the PHYPADRAFT_192523 gene.

  • Western blotting: For detecting protein levels in different tissues or under various conditions, particularly effective when combined with subcellular fractionation techniques.

When designing localization experiments, researchers should include appropriate controls and consider that CASP-like proteins may form specialized membrane domains that could be visualized as discrete puncta or continuous strips depending on developmental stage .

How can CRISPR-Cas9 be optimally applied to study PHYPADRAFT_192523 function?

CRISPR-Cas9 offers a powerful approach for studying PHYPADRAFT_192523 function in P. patens through targeted mutagenesis:

Guide RNA design protocol:

  • Select target sequences within the PHYPADRAFT_192523 gene with minimal off-target potential

  • Design protospacer sequences (20 nucleotides) followed by PAM site (NGG)

  • For complete gene knockout, target early exons or multiple sites simultaneously

Transformation methodology:

  • Clone guide RNA into appropriate vector containing Cas9 and selection marker

  • Transform P. patens protoplasts using PEG-mediated transformation

  • Select transformants on appropriate media

  • Confirm mutations through sequencing

The high efficiency of homologous recombination in P. patens (superior to other plant systems) makes it particularly suitable for precise genome editing applications . This approach can generate clean knockout mutants for functional studies or introduce specific mutations to study structure-function relationships.

What protein purification protocol yields the highest quality PHYPADRAFT_192523?

Based on the recombinant PHYPADRAFT_192523 characteristics, the following purification protocol is recommended:

Purification protocol:

  • Express His-tagged PHYPADRAFT_192523 in E. coli system

  • Harvest cells and lyse using sonication in buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • Protease inhibitor cocktail

  • Clarify lysate by centrifugation (15,000 × g, 30 min)

  • Purify using Ni-NTA affinity chromatography:

    • Binding: 10 mM imidazole

    • Washing: 20-50 mM imidazole

    • Elution: 250 mM imidazole gradient

  • Apply size exclusion chromatography for higher purity

  • Verify purity by SDS-PAGE and Western blotting

For functional studies, researchers should test protein activity immediately after purification as CASP-like proteins may lose activity during extended storage .

How can protein-protein interactions of PHYPADRAFT_192523 be investigated?

Multiple complementary approaches can identify PHYPADRAFT_192523 interaction partners:

  • Yeast two-hybrid (Y2H) screening:

    • Clone PHYPADRAFT_192523 as bait construct

    • Screen against P. patens cDNA library

    • Validate interactions with directed Y2H assays

  • Co-immunoprecipitation (Co-IP):

    • Express tagged PHYPADRAFT_192523 in P. patens

    • Perform IP with anti-tag antibodies

    • Identify interacting proteins by mass spectrometry

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse PHYPADRAFT_192523 and candidate partners with split fluorescent protein fragments

    • Co-express in P. patens

    • Visualize reconstituted fluorescence at interaction sites

  • Proximity-dependent biotin identification (BioID):

    • Fuse PHYPADRAFT_192523 with biotin ligase

    • Express in P. patens to biotinylate proximal proteins

    • Purify and identify biotinylated proteins

When analyzing potential interactions, researchers should consider that CASP proteins in vascular plants interact with receptor kinases and oxidases in signaling pathways controlling cell wall modifications .

How can researchers investigate PHYPADRAFT_192523's role in cell wall formation?

Cell wall analysis requires a multi-faceted approach:

Methodological workflow:

Researchers should focus on developmental time points when cell wall specialization occurs, as CASP-like proteins may function transiently during specific developmental windows .

What approaches can reveal PHYPADRAFT_192523's potential role in ROS signaling pathways?

Based on the relationship between CASP proteins and ROS production in vascular plants , researchers can investigate PHYPADRAFT_192523's role in ROS signaling through:

  • ROS detection methods:

    • NBT staining for superoxide

    • DAB staining for hydrogen peroxide

    • H2DCFDA fluorescent probe for intracellular ROS

    • Genetically encoded ROS sensors for live imaging

  • Genetic interaction studies:

    • Generate double mutants with P. patens NADPH oxidase homologs

    • Complement rbohD/F mutants with PHYPADRAFT_192523 to assess functional relationships

  • Pharmacological approaches:

    • Apply ROS inhibitors (DPI, SHAM) and assess effects on PHYPADRAFT_192523 localization

    • Use ROS generators to determine if PHYPADRAFT_192523 localization or function is ROS-dependent

  • Transcriptional analysis:

    • Examine expression changes in ROS-related genes in PHYPADRAFT_192523 mutants

    • Analyze PHYPADRAFT_192523 expression in response to oxidative stress

When designing these experiments, researchers should consider that in Arabidopsis, CASP proteins coordinate ROS production through interaction with NADPH oxidases, leading to localized cell wall modifications .

How can glycoengineering approaches be applied to optimize PHYPADRAFT_192523 for research applications?

P. patens offers unique advantages for glycoengineering of PHYPADRAFT_192523:

Methodological approach:

  • Analyze native glycosylation pattern of PHYPADRAFT_192523 using mass spectrometry

  • Identify glycosylation sites through bioinformatic prediction and site-directed mutagenesis

  • Apply targeted knockout of P. patens glycosylation enzymes using homologous recombination to modify glycosylation patterns

  • Express modified PHYPADRAFT_192523 in glycoengineered P. patens strains

  • Assess functional consequences of altered glycosylation on:

    • Protein stability

    • Subcellular localization

    • Interaction with binding partners

    • Enzymatic activity

P. patens is particularly valuable for glycoengineering studies due to the possibility of generating targeted knockout mutants for glycoengineering and quantitative optimization for protein production .

How can researchers overcome expression and solubility challenges with recombinant PHYPADRAFT_192523?

Common challenges with CASP-like protein expression include insolubility and inclusion body formation. Researchers can implement the following strategies:

Troubleshooting protocol:

  • For E. coli expression systems:

    • Optimize induction conditions (lower temperature of 16-18°C, reduced IPTG concentration)

    • Use solubility-enhancing fusion tags (MBP, SUMO) in addition to His-tag

    • Try specialized E. coli strains (Rosetta for rare codons, Origami for disulfide bonds)

    • Screen different buffer compositions for extraction and purification

  • For P. patens expression system:

    • Optimize promoter strength and induction timing

    • Target protein to specific subcellular compartments

    • Co-express chaperones or folding enhancers

    • Implement controlled growth conditions (temperature, light, media composition)

  • Refolding strategies (if inclusion bodies persist):

    • Solubilize in 8M urea or 6M guanidine-HCl

    • Perform step-wise dialysis for refolding

    • Use additives like L-arginine or sucrose to prevent aggregation during refolding

Success should be validated through activity assays appropriate for CASP-like proteins, such as membrane association tests or interaction studies with known partners .

What analytical methods can effectively differentiate PHYPADRAFT_192523 functionality from other CASP-like proteins?

To distinguish PHYPADRAFT_192523 functions from other CASP-like proteins:

  • Complementation assays:

    • Express PHYPADRAFT_192523 in Arabidopsis casp mutants

    • Assess restoration of Casparian strip formation using PI uptake assays

    • Quantify degree of functional complementation

  • Domain swap experiments:

    • Create chimeric proteins between PHYPADRAFT_192523 and vascular plant CASPs

    • Express in appropriate mutant backgrounds

    • Identify domains responsible for specific functions

  • Comparative localization studies:

    • Co-express fluorescently tagged PHYPADRAFT_192523 with other CASP-like proteins

    • Analyze co-localization patterns and potential differences in membrane domain formation

  • Interaction partner profiling:

    • Compare interactomes of PHYPADRAFT_192523 and other CASP-like proteins

    • Identify unique vs. shared interaction partners

These approaches help define the evolutionary conservation and divergence of CASP-like protein functions across plant lineages .

How can researchers accurately interpret contradictory data regarding PHYPADRAFT_192523 function?

When faced with conflicting experimental results:

  • Systematic validation approach:

    • Verify protein expression levels in different experimental systems

    • Confirm mutant genotypes through multiple methods (PCR, sequencing, Western blotting)

    • Use multiple independent transgenic/mutant lines to rule out position effects

  • Reconciliation strategies:

    • Consider developmental timing effects (CASP proteins show stage-specific activities)

    • Evaluate environmental conditions impact (stress responses may alter function)

    • Assess genetic background effects (particularly in cross-species studies)

  • Comprehensive phenotyping:

    • Apply multiple complementary techniques to assess the same phenotype

    • Quantify phenotypes rigorously with appropriate statistical analysis

    • Use time-course studies to capture dynamic processes

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Look for consistent patterns across different data types

    • Apply systems biology approaches to model complex interactions

Researchers should particularly note that CASP protein function is highly context-dependent, with activities potentially varying based on presence of interacting partners, developmental stage, and environmental conditions .

What are the key specifications for recombinant PHYPADRAFT_192523 production?

SpecificationDetailsNotes
Full Protein NameRecombinant Full Length Physcomitrella Patens Subsp. Patens CASP-like Protein PHYPADRAFT_192523Official nomenclature
Expression HostE. coliCurrent production system
Protein Length191 amino acids (Full Length)Complete coding sequence
Affinity TagHis-tagFor purification purposes
Species SourcePhyscomitrella patens subsp. patens (Moss)Non-vascular plant model
Molecular WeightApproximately 21 kDaExcluding tag contribution
Theoretical pI5.8-6.2Predicted range for CASP-like proteins
Storage Recommendations-80°C in buffer with 10% glycerolFor maintaining activity
StabilityAvoid repeated freeze-thaw cyclesBased on similar proteins

What experimental systems are suitable for PHYPADRAFT_192523 functional studies?

Experimental SystemApplicationsAdvantagesLimitations
P. patens native systemGene knockout, localization, protein-protein interactionsHigh homologous recombination efficiency; native cellular context; suitable for cell suspension cultures Limited tools compared to Arabidopsis; slower growth
E. coli expressionRecombinant protein production, biochemical characterizationHigh yield; simple culture conditions; established purification methods Lacks plant-specific post-translational modifications
Arabidopsis transgenicsComplementation studies, comparative functionWell-characterized CASP mutants available; efficient transformation May not reflect native function due to species differences
Yeast systemsProtein-protein interaction studiesRapid growth; well-established methods for membrane proteinsLacks plant-specific interacting partners
In vitro biochemical assaysEnzymatic activity, binding studiesControlled conditions; quantitative analysisMay not reflect in vivo complexity

When selecting experimental systems, researchers should consider that P. patens offers uniquely efficient homologous recombination, making it particularly valuable for targeted genetic manipulations not easily achieved in other plant systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.