Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_232936 (PHYPADRAFT_232936)

Shipped with Ice Packs
In Stock

Description

Functional Context in Physcomitrella patens

CASP-like proteins in P. patens are implicated in:

  • Membrane Scaffolding: Formation of membrane domains that restrict lateral diffusion of membrane proteins, analogous to CASP-mediated Casparian strip domains in vascular plants .

  • Stress Response Modulation: Interaction with ABA signaling pathways, as CASPL proteins in mosses regulate dehydration tolerance and osmotic stress responses .

  • Evolutionary Insight: PHYPADRAFT_232936 represents an ancestral CASPL clade predating the emergence of true Casparian strips, highlighting functional diversification during land plant evolution .

Research Applications

  • Comparative Studies: Used to investigate the evolution of CASP functions across bryophytes and vascular plants .

  • Protein Interaction Assays: Serves as a tool to study membrane domain formation and cell wall modification mechanisms .

  • Stress Physiology: Potential utility in analyzing ABA-dependent drought responses, given CASPL links to stress-activated kinases .

Expression and Purification

  • Production: Expressed recombinantly in E. coli, with optimization for solubility and stability .

  • Purity: >90% (SDS-PAGE verified) .

  • Activity: Functional assays pending publication, though structural homology suggests membrane localization and scaffolding activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us and we will prioritize developing the specified tag.
Synonyms
PHYPADRAFT_232936; CASP-like protein 1U3; PpCASPL1U3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_232936
Target Protein Sequence
MNGATVQPSYKEAGPVRYHPMHDCLSLILRLLTLGATIAAIVAMLKSTQTVPTLLGPHTA RWKDFPAFEWFVIGNSIVLVYAALGTLAACLSLFTRRGPLSYTKTAWLTFLCDFICSCAL ISAGSTALGVAWIGKHGQHSAFWNAVCPTVDRFCDYVQGALIATLCGFIFQALSTVIAAS ALHNLATHRH
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Physcomitrella patens serve as a model organism for studying CASP-like proteins?

Physcomitrella patens has emerged as an excellent model system for studying CASP-like proteins due to several key advantages. As a non-vascular plant, it represents an evolutionary position that provides insights into the development of protein functions across plant lineages . The most significant advantage of P. patens is its exceptional capacity for homologous recombination, which enables precise genetic manipulation for functional studies .

When investigating CASP-like proteins such as PHYPADRAFT_232936, researchers can employ targeted gene knockout approaches to assess phenotypic changes and determine protein function. The methodology involves:

  • Designing targeting constructs with homologous flanking regions

  • Transformation of P. patens protoplasts using polyethylene glycol (PEG) mediated protocols

  • Selection of stable transformants

  • Phenotypic and molecular characterization of mutants

This system allows for direct interrogation of gene function that would be considerably more challenging in other plant models where homologous recombination is less efficient .

What are the optimal conditions for expressing recombinant PHYPADRAFT_232936?

Recombinant expression of PHYPADRAFT_232936 can be achieved in several systems, with E. coli being commonly used as evidenced by commercial availability of His-tagged versions . For optimal expression, consider the following methodological approach:

Expression System Selection:

  • E. coli: Suitable for basic structural studies and antibody production

  • P. patens cell cultures: Preferred for native post-translational modifications

E. coli Expression Optimization Table:

ParameterRecommended ConditionNotes
E. coli strainBL21(DE3) or RosettaRosetta strain compensates for rare codons
Induction temperature16-18°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMOptimize through small-scale trials
Induction duration16-20 hoursExtended period at lower temperature
Media supplements2% glucose, 0.5M sorbitolStabilizes membrane proteins

Purification Strategy:

  • Solubilization with mild detergents (0.5-1% DDM or LDAO)

  • Immobilized metal affinity chromatography using His-tag

  • Size exclusion chromatography for final purification

For researchers focusing on functional studies, expression in the native P. patens system may provide advantages for proper folding and post-translational modifications, though yields may be lower than bacterial systems .

How can researchers effectively design experiments to investigate PHYPADRAFT_232936 cellular localization?

Investigating the cellular localization of PHYPADRAFT_232936 requires a multi-faceted experimental approach:

Fluorescent Protein Fusion Strategy:

  • Create C-terminal and N-terminal GFP/mCherry fusion constructs

  • Transform into P. patens protoplasts

  • Verify expression using Western blot analysis

  • Observe localization using confocal microscopy

Complementary Methods for Validation:

  • Immunogold electron microscopy using anti-PHYPADRAFT_232936 antibodies

  • Subcellular fractionation followed by Western blot analysis

  • Co-localization studies with known compartment markers

Based on the amino acid sequence analysis of PHYPADRAFT_232936, which contains transmembrane domains and hydrophobic regions, researchers should pay particular attention to membrane structures including plasma membrane, ER, and Golgi apparatus . When analyzing results, consider that fusion proteins may occasionally interfere with targeting signals, necessitating both N- and C-terminal fusion constructs for comparison.

How can CRISPR-Cas9 be utilized to study PHYPADRAFT_232936 function in Physcomitrella patens?

While Physcomitrella patens has traditionally been manipulated through homologous recombination, CRISPR-Cas9 technology offers additional advantages for studying PHYPADRAFT_232936. The methodology should follow these key steps:

  • gRNA Design:

    • Target specific regions of PHYPADRAFT_232936 gene

    • Use moss-optimized promoters (e.g., U6 promoter)

    • Design multiple gRNAs to increase editing efficiency

  • Delivery System:

    • PEG-mediated transformation of protoplasts

    • Co-delivery of Cas9 and gRNA expression cassettes

    • Selection marker integration for transformant identification

  • Editing Verification:

    • PCR amplification of target region followed by sequencing

    • T7 Endonuclease I assay for detection of mutations

    • Western blotting to confirm protein knockout

  • Phenotypic Analysis:

    • Morphological characterization

    • Growth rate comparisons

    • Stress response assessment

    • Membrane integrity assays

What methods are effective for identifying protein-protein interactions involving PHYPADRAFT_232936?

Understanding the interaction partners of PHYPADRAFT_232936 is crucial for elucidating its function. Several complementary approaches can be employed:

Yeast Two-Hybrid (Y2H) Screening:

  • Consider using split-ubiquitin Y2H for membrane proteins

  • Create bait constructs with different domains of PHYPADRAFT_232936

  • Screen against P. patens cDNA library

Co-Immunoprecipitation (Co-IP):

  • Generate specific antibodies against PHYPADRAFT_232936

  • Alternatively, use tagged versions (His, FLAG, or HA)

  • Perform pull-downs followed by mass spectrometry analysis

Proximity-Dependent Biotin Identification (BioID):

  • Create fusion of PHYPADRAFT_232936 with BirA* biotin ligase

  • Express in P. patens

  • Identify biotinylated proteins using streptavidin pull-down and mass spectrometry

In silico Prediction and Validation:

  • Use protein-protein interaction databases and prediction tools

  • Validate top candidates experimentally

  • Consider evolutionary conservation patterns

When interpreting interaction data, researchers should be aware that membrane proteins like PHYPADRAFT_232936 can present technical challenges, including false negatives due to improper folding in heterologous systems and false positives from hydrophobic interactions . Validation through multiple independent methods is strongly recommended.

How should researchers approach comparative analysis of PHYPADRAFT_232936 with other CASP-like proteins?

Comparative analysis of PHYPADRAFT_232936 with other CASP-like proteins requires systematic bioinformatic and experimental approaches. Consider this methodological framework:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with CASP-like proteins from other species

    • Phylogenetic tree construction to determine evolutionary relationships

    • Identification of conserved domains and motifs

  • Structural Comparison:

    • Homology modeling based on available CASP protein structures

    • Comparison of predicted transmembrane topology

    • Analysis of conserved structural features

  • Functional Comparison:

    • Expression pattern analysis across different species

    • Phenotypic comparison of knockout/knockdown mutants

    • Complementation studies across species

Comparative Analysis Table Example:

FeaturePHYPADRAFT_232936Arabidopsis CASPAnimal CASPAnalytical Method
Size190 aaVaries (170-210 aa)VariesSequence analysis
Membrane domainsPredicted 4 TM domains3-4 TM domains2-4 TM domainsTMHMM, Phobius
Conservation-~40-60% similarity~30-40% similarityBLAST, Clustal Omega
Cellular locationPredicted membraneMembraneMembranePrediction, GFP fusion
Knockout phenotypeTo be determinedGrowth defectsOften lethalGenetic studies

When interpreting comparative data, researchers should account for the evolutionary distance between moss and other plant species, which may affect functional conservation despite sequence similarities .

What strategies help resolve contradictory experimental results when studying PHYPADRAFT_232936?

When faced with contradictory results in PHYPADRAFT_232936 research, a systematic approach to reconciliation is essential:

  • Methodological Validation:

    • Exhaustively review experimental protocols for differences

    • Assess reagent quality and specificity (especially antibodies)

    • Evaluate genetic background consistency of model organisms

  • Contextual Analysis:

    • Compare growth conditions and developmental stages

    • Assess environmental factors that might influence results

    • Consider tissue-specific or cell-type-specific effects

  • Technical Replication and Validation:

    • Employ alternative techniques to measure the same parameter

    • Increase biological and technical replicates

    • Use statistical approaches appropriate for the data type

  • Literature Integration:

    • Conduct systematic reviews of related research

    • Consult experts in the specific techniques involved

    • Consider evolutionary context when comparing across species

A common source of contradictions in CASP-like protein research stems from differences in expression systems - results obtained in heterologous systems may differ from those in native P. patens due to differences in post-translational modifications, membrane composition, or interacting partners . Researchers should explicitly address these considerations when publishing seemingly contradictory findings.

What are promising approaches for elucidating the physiological role of PHYPADRAFT_232936 in moss development?

To comprehensively investigate the physiological role of PHYPADRAFT_232936, researchers should consider these methodological approaches:

  • Temporal and Spatial Expression Analysis:

    • RNA-seq across developmental stages

    • Tissue-specific promoter analysis

    • In situ hybridization to localize expression patterns

  • Conditional Knockout/Knockdown Strategies:

    • Inducible CRISPR systems

    • Temperature-sensitive alleles

    • Tissue-specific gene silencing

  • Environmental Response Studies:

    • Stress conditions (drought, salinity, temperature)

    • Hormone treatments

    • Pathogen challenge assays

  • Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics

    • Network analysis to identify associated pathways

    • Comparative analysis with vascular plants

Based on the transmembrane nature of PHYPADRAFT_232936, researchers should pay particular attention to processes involving membrane remodeling, such as cell expansion, polarized growth, and responses to environmental stresses that affect membrane integrity .

How can advanced imaging techniques enhance our understanding of PHYPADRAFT_232936 dynamics?

Advanced imaging approaches offer powerful tools for investigating PHYPADRAFT_232936 dynamics in living cells:

Super-resolution Microscopy:

  • Stimulated Emission Depletion (STED) microscopy

  • Photoactivated Localization Microscopy (PALM)

  • Stochastic Optical Reconstruction Microscopy (STORM)

These techniques can overcome the diffraction limit of conventional microscopy, allowing visualization of nanoscale distributions of PHYPADRAFT_232936 within membrane structures.

Live-cell Imaging Approaches:

  • Fluorescence Recovery After Photobleaching (FRAP)

    • Measures protein mobility within membranes

    • Can determine if PHYPADRAFT_232936 is freely diffusing or anchored

  • Förster Resonance Energy Transfer (FRET)

    • Investigates protein-protein interactions in real-time

    • Can detect conformational changes in PHYPADRAFT_232936

  • Single-particle tracking

    • Follows individual molecules over time

    • Reveals heterogeneity in protein behavior

When implementing these techniques, researchers should carefully consider the choice of fluorescent tags, as bulky fluorescent proteins may interfere with the normal localization or function of membrane proteins like PHYPADRAFT_232936 . Smaller tags such as FlAsH/ReAsH systems or split-GFP approaches may provide alternatives with less functional interference.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.