Recombinant Physcomitrella patens subsp. patens CASP-like protein PHYPADRAFT_73452 (PHYPADRAFT_73452)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PHYPADRAFT_73452; CASP-like protein UU5; PpCASPLUU5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_73452
Target Protein Sequence
MSTVAQDSAPGGGKIQDAMEQGAPGASSAAVVPEGGHYTQTPSPAFQAVKKNINHMSAFS LGLRVAEFVLSVIAFSLMASADQNGAVYSTFTSYSFVLAVNVLVVFYTIGQIIMSVLLLV SGSTPKKIYLFITFGCDQLSAFLLMAAGAAGASVALIINRGGVTDAYGNGCIDGKITSFC SHAQASVAFTFLSFFCMVISSLLGVYSLAPYLIL
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does PHYPADRAFT_73452 differ from CASP proteins in vascular plants?

PHYPADRAFT_73452 from Physcomitrella patens represents an evolutionary distinct CASP-like protein compared to those found in vascular plants. A critical difference is that Physcomitrella patens CASP-like proteins lack the nine-amino acid signature (ESLPFFTQF) in the first extracellular loop that is highly conserved in spermatophytes (seed plants) . This signature is completely absent in the moss genome, suggesting that PHYPADRAFT_73452 may have different functional properties or localization patterns compared to CASP proteins in higher plants.

The absence of this signature correlates with the evolutionary development of Casparian strips, specialized cell wall modifications found in the endodermis of vascular plants but absent in mosses like Physcomitrella patens . This makes PHYPADRAFT_73452 valuable for studying the evolutionary development of plant barrier functions and specialized membrane domains.

What are the optimal expression and purification methods for recombinant PHYPADRAFT_73452?

The recommended expression system for recombinant PHYPADRAFT_73452 is E. coli with an N-terminal His-tag for purification purposes . Based on available protocols, the following methodological approach is advised:

Expression Protocol:

  • Transform expression vector containing the PHYPADRAFT_73452 gene into a suitable E. coli strain

  • Culture cells at optimal temperature (typically 37°C until OD600 reaches ~0.6-0.8)

  • Induce protein expression with IPTG (typically 0.1-1 mM)

  • Continue culture at lower temperature (16-25°C) for 16-20 hours to enhance proper folding

Purification Protocol:

  • Harvest cells by centrifugation and lyse using appropriate buffer with protease inhibitors

  • Purify using Ni-NTA affinity chromatography

  • Perform buffer exchange to remove imidazole

  • Further purify using size exclusion chromatography if higher purity is required

  • Lyophilize the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Recommendations:

  • Store lyophilized protein at -20°C/-80°C

  • After reconstitution, aliquot the protein with 5-50% glycerol (recommended final concentration: 50%)

  • Store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

How can researchers effectively monitor PHYPADRAFT_73452 localization in heterologous expression systems?

Based on studies with related CASP proteins, researchers can employ the following methodological approach to investigate PHYPADRAFT_73452 localization:

  • Fusion Protein Construction: Generate fluorescent protein fusions (GFP or mCherry) with PHYPADRAFT_73452, ideally at both N- and C-termini to determine optimal configuration for protein function

  • Expression System Selection:

    • For plant studies: Use Arabidopsis or tobacco transient expression systems

    • For cell culture: Consider moss protoplasts for homologous expression

  • Imaging Techniques:

    • Confocal microscopy for initial localization

    • Super-resolution microscopy (STED or PALM) for detailed membrane domain analysis

    • FRAP (Fluorescence Recovery After Photobleaching) to analyze protein dynamics within membrane domains

  • Controls and Validation:

    • Co-express with known plasma membrane markers

    • Include wild-type CASP1 from Arabidopsis as a positive control for membrane domain formation

    • Perform immunolocalization with specific antibodies as an independent validation method

Researchers should note that mutations in conserved residues can significantly affect localization patterns. Particularly important are the conserved residues in transmembrane domains and the second extracellular loop. Mutations in the MARVEL/CASPL conserved Asp residue in TM3 (equivalent to D134 in AtCASP1) may completely prevent proper protein expression or folding .

How does PHYPADRAFT_73452 compare to other CASP-like proteins in evolutionary and functional terms?

PHYPADRAFT_73452 represents an early evolutionary form of CASP-like proteins, providing valuable insights into the development of specialized membrane domains in plants. The following comparative analysis highlights key differences and similarities:

FeaturePHYPADRAFT_73452 (Moss)Seed Plant CASPsFunctional Significance
Nine-amino acid signature in EL1AbsentPresent (ESLPFFTQF)Correlates with ability to form Casparian strips
Transmembrane domainsConservedConservedEssential for membrane localization
MARVEL domain homologyPresentPresentSuggests ancestral role in membrane organization
Second extracellular loop (EL2)Partially conservedHighly conservedImportant for protein function; mutations affect localization
Association with Casparian stripsNo Casparian strips in mossDirect role in formationEvolutionary specialization for vascular plant barriers
Ability to form membrane domainsLikely present but differentForms Casparian Strip Domain (CSD)Fundamental capacity preserved across evolution

This comparative framework suggests that PHYPADRAFT_73452 represents an ancestral form of CASP proteins that predates the specialized functions seen in vascular plants. The conservation of transmembrane domains and partial conservation of extracellular loops indicates a fundamental role in membrane organization that has been retained throughout plant evolution .

What experimental approaches can determine if PHYPADRAFT_73452 can functionally complement Arabidopsis CASP mutants?

To assess functional complementation, researchers should consider this systematic experimental approach:

  • Construct Generation:

    • Create expression vectors with PHYPADRAFT_73452 under control of the Arabidopsis CASP1 promoter

    • Include fluorescent tags for localization monitoring

    • Generate chimeric proteins swapping domains between PHYPADRAFT_73452 and AtCASP1

  • Transformation and Selection:

    • Transform constructs into Arabidopsis casp1 or multiple casp mutants

    • Select transformants and confirm expression using RT-PCR and western blotting

  • Functional Assays:

    • Assess Casparian strip integrity using propidium iodide penetration assay

    • Evaluate suberin deposition using fluorescent staining

    • Measure ion leakage to determine functional barrier restoration

    • Compare growth parameters under stress conditions

  • Localization Analysis:

    • Determine if PHYPADRAFT_73452 localizes to the Casparian strip domain

    • Assess co-localization with other CASP proteins and CASP-associated proteins

How can PHYPADRAFT_73452 be used to study the evolution of plasma membrane domain formation?

PHYPADRAFT_73452 provides a unique opportunity to investigate the evolutionary development of specialized membrane domains in plants. The following research strategies could yield valuable insights:

  • Comparative Domain Analysis:

    • Express fluorescently tagged PHYPADRAFT_73452 in both moss and Arabidopsis

    • Compare its ability to form discrete membrane domains in these different systems

    • Analyze dynamics and stability of these domains using FRAP and other live-cell imaging techniques

  • Chimeric Protein Studies:

    • Create fusion proteins combining domains from PHYPADRAFT_73452 and vascular plant CASPs

    • Identify which domains are necessary and sufficient for proper localization

    • Determine if adding the nine-amino acid signature from seed plant CASPs can confer endodermal localization ability to PHYPADRAFT_73452

  • Protein-Protein Interaction Networks:

    • Perform co-immunoprecipitation experiments with PHYPADRAFT_73452 expressed in different systems

    • Identify interacting partners using mass spectrometry

    • Compare interactomes between moss and vascular plant systems to identify conserved and divergent interaction networks

  • Membrane Biophysical Properties:

    • Use advanced microscopy (FRET, FCS) to analyze how PHYPADRAFT_73452 affects membrane fluidity and organization

    • Compare with effects of vascular plant CASPs to determine evolutionary changes in membrane-organizing capabilities

These approaches could reveal how the basic mechanisms of membrane domain formation evolved from bryophytes to vascular plants, potentially uncovering fundamental principles of plasma membrane organization in plants .

What are the challenges in determining the native function of PHYPADRAFT_73452 in Physcomitrella patens?

Investigating the native function of PHYPADRAFT_73452 in its original moss context presents several methodological challenges:

  • Lack of Known Phenotypes:

    • Unlike vascular plant CASPs, which have clear roles in Casparian strip formation, the native function of PHYPADRAFT_73452 is not immediately apparent

    • Researchers must design experiments to identify potential phenotypes under various stress conditions

  • Functional Redundancy:

    • The moss genome may contain multiple CASP-like proteins with overlapping functions

    • Complete functional analysis may require generation of multiple knockout lines

  • Methodological Approaches:

    • Genetic Manipulation: Use CRISPR-Cas9 to generate knockout and knockdown lines

    • Expression Analysis: Perform RNA-seq under various conditions to identify when the gene is expressed

    • Localization Studies: Create fluorescent fusions to determine subcellular localization in native tissue

    • Physiological Assays: Test mutants for altered responses to osmotic stress, ion transport, pathogen susceptibility, and cell wall properties

  • Proposed Experimental Workflow:

    • Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Perform comprehensive phenotypic screening under normal and stress conditions

    • Conduct cell biological analyses focusing on plasma membrane organization

    • Investigate potential roles in specialized cell wall modifications in moss tissues

Understanding the native function would provide critical insights into how CASP proteins functioned before they were recruited for Casparian strip formation in vascular plants, potentially revealing ancestral functions related to membrane organization and cell wall modifications .

What strategies can overcome protein solubility issues when working with recombinant PHYPADRAFT_73452?

Membrane proteins like PHYPADRAFT_73452 often present solubility challenges. The following methodological approaches can help researchers overcome these issues:

  • Optimization of Expression Conditions:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

    • Vary induction temperatures (16°C, 20°C, 25°C)

    • Test different IPTG concentrations (0.1 mM to 1 mM)

    • Consider auto-induction media for gentle protein expression

  • Protein Engineering Approaches:

    • Generate truncated versions removing hydrophobic regions

    • Create fusion constructs with solubility enhancers (MBP, SUMO, Trx)

    • Consider codon optimization for E. coli expression

  • Purification Optimization:

    • Include mild detergents in lysis and purification buffers (0.1% DDM, LDAO, or Triton X-100)

    • Test different buffer compositions (pH range 6.5-8.5)

    • Add stabilizing agents (glycerol 5-10%, trehalose 6%)

    • Use gradient elution during affinity chromatography

  • Refolding Strategies:

    • If inclusion bodies form, develop a refolding protocol using gradual dialysis

    • Test different refolding additives (L-arginine, reduced/oxidized glutathione)

The current recommended protocol produces the protein with greater than 90% purity as determined by SDS-PAGE . For reconstitution, researchers should centrifuge the vial briefly and reconstitute in deionized sterile water to 0.1-1.0 mg/mL, then add glycerol to 5-50% final concentration for long-term storage .

How can researchers address the challenge of functional validation when the native role of PHYPADRAFT_73452 remains unclear?

When working with a protein of uncertain native function like PHYPADRAFT_73452, researchers can employ these strategic approaches:

  • Comparative Functional Analysis:

    • Perform cross-species complementation studies (express in Arabidopsis casp mutants)

    • Compare phenotypes with knockouts of related proteins in model systems

    • Use the protein as bait in yeast two-hybrid or split-ubiquitin assays to identify interacting partners

  • Structure-Function Relationships:

    • Conduct site-directed mutagenesis of conserved residues in transmembrane domains and extracellular loops

    • Focus particularly on the conserved Asp residue in TM3 that is critical for proper folding

    • Test mutations in conserved residues of EL2, which affect protein localization and function

  • Systems Biology Approaches:

    • Perform transcriptomic analysis of knockout lines to identify altered pathways

    • Conduct metabolomic profiling to detect biochemical changes

    • Use phosphoproteomic analysis to identify potential signaling pathways affected

  • Proposed Experimental Workflow:

    • Generate PHYPADRAFT_73452 knockout lines in Physcomitrella

    • Perform comprehensive phenotypic analysis under various conditions

    • Conduct targeted assays for membrane integrity, cell wall composition, and stress responses

    • Use heterologous expression in both plant and non-plant systems to test for conserved functions

By applying these multifaceted approaches, researchers can develop hypotheses about the ancestral functions of CASP-like proteins before their specialization for Casparian strip formation in vascular plants, potentially revealing fundamental mechanisms of membrane organization that have been conserved throughout plant evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.