Recombinant Physcomitrella patens subsp. patens Chlorophyll a-b binding protein, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PHYPADRAFT_124625; PHYPADRAFT_163091; Chlorophyll a-b binding protein, chloroplastic; LHCII type I CAB; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-269
Protein Length
Full Length of Mature Protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
PHYPADRAFT_124625
Target Protein Sequence
RRTVSKSAGSDTIWYGADRPKFLGPFSGETPSYLNGEFAGDYGWDTAGLSSDPETFARNR ELEVIHARWAMLGALGCLTPELLAKSGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQ SILAIWACQVVLMGAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPDTFAELKVKEIK NGRLAMFSMFGFFVQAIVTGKGPLENLNDHLADPVANNAWAYAPTSPPGTR
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What makes Physcomitrella patens advantageous as a model organism for recombinant protein expression?

Physcomitrella patens has emerged as a powerful model organism for both evolutionary-developmental (evo-devo) research and biotechnological applications, including recombinant protein production. The moss possesses several unique advantages that make it particularly suitable for these purposes. Physcomitrella has exceptional genetic amenability due to its haploid dominant lifecycle phase and remarkably high rate of homologous recombination, enabling precise gene targeting and genome engineering . This feature allows researchers to perform targeted gene knockouts and insertions with significantly higher efficiency than in other plant systems. Additionally, Physcomitrella can be grown in reproducible bioreactor cultivation systems, providing scalable and controlled conditions for protein production . The moss also has the capacity for humanized protein glycosylation patterns, with successful elimination of plant-specific β1,2-xylosylation, α1,3-fucosylation, β1,3-galactosylation, and Lewis A epitopes through targeted gene knockouts . This ability to produce proteins with more humanized N-glycan patterns is particularly valuable for pharmaceutical applications.

What is the significance of chlorophyll a-b binding protein (lhcsr1) in Physcomitrella patens?

The chlorophyll a-b binding protein lhcsr1 plays a critical role in light harvesting and photoprotection in Physcomitrella patens. Beyond its physiological importance, the lhcsr1 gene and particularly its promoter have become valuable tools in molecular biology research. The lhcsr1 promoter has demonstrated exceptional strength in driving heterologous gene expression, outperforming commonly used promoters in plant biotechnology . Research has shown that this endogenous promoter drives expression of reporter genes like GFP in protoplasts significantly (more than twofold) better than the widely used 2x 35S promoter or the rice actin1 promoter . This makes the lhcsr1 promoter particularly valuable for recombinant protein production in Physcomitrella. Furthermore, a shortened 677 bp version of the lhcsr1 promoter has been identified that maintains full activity in protoplasts, providing researchers with a compact yet powerful tool for gene expression . The combination of this promoter with codon-optimized sequences has been shown to yield up to sixfold increased expression, demonstrating its utility in recombinant protein production systems .

How can the lhcsr1 promoter be optimized for maximum heterologous gene expression?

The lhcsr1 promoter optimization for heterologous gene expression requires a multifaceted approach focusing on both sequence optimization and experimental validation. The full-length lhcsr1 promoter demonstrates exceptional strength, but research has identified a truncated 677 bp version that retains complete activity in protoplasts . This shortened version offers practical advantages for vector construction while maintaining the strong expression capabilities of the full-length promoter. To maximize expression efficiency, researchers should consider implementing the following methodological approach:

  • Comparative analysis against standard promoters: Validate the lhcsr1 promoter performance by conducting side-by-side comparisons with established promoters such as 2x 35S and rice actin1 using standardized reporter assays .

  • Normalization techniques: For accurate quantification of promoter activity, implement a dual-reporter system using mCherry under 2x 35S promoter control as a second reporter to normalize for variable transfection efficiencies in protoplasts .

  • Deletion analysis: Create and test a series of deletion variants to identify the minimal promoter region that maintains full activity, which can simplify vector construction while preserving expression strength .

  • Combinatorial approach: For optimal results, combine the optimized lhcsr1 promoter with codon-optimized coding sequences, which has been demonstrated to yield up to sixfold increased expression of fluorescent proteins compared to standard configurations .

What codon optimization strategies are most effective for enhancing recombinant protein expression in Physcomitrella patens?

Codon optimization represents a critical factor in achieving robust heterologous protein expression in Physcomitrella patens. Implementing effective codon optimization requires specific methodological considerations tailored to this moss system:

  • Adapt to moss-specific codon usage bias: Analyze the codon usage frequency in highly expressed Physcomitrella genes and adjust heterologous gene sequences accordingly to match these preferences .

  • Prevent hetero-splicing events: Physcomitrella contains numerous introns and utilizes complex splicing mechanisms. Effective codon optimization must eliminate cryptic splice sites that could lead to aberrant mRNA processing .

  • Optimize GC content: Adjust the GC content of coding sequences to match that of highly expressed moss genes, which can improve mRNA stability and translation efficiency .

  • Comparative validation approach: When implementing codon optimization, create multiple variants with different optimization algorithms and validate their performance experimentally. For instance, codon-optimized GFP has been shown to yield significantly (more than twofold) stronger fluorescence signals compared to non-optimized versions .

  • Avoid rare codon clusters: Eliminate clusters of rare codons that might cause ribosomal pausing and reduce translation efficiency, particularly at the 5' end of the coding sequence .

A systematic approach combining these strategies has been demonstrated to substantially increase expression levels, with documented cases showing more than twofold improvement in fluorescence signal intensity for reporter proteins .

What methodologies are most effective for evaluating recombinant protein production in Physcomitrella protoplasts?

Reliable evaluation of recombinant protein production in Physcomitrella protoplasts requires specialized methodologies that account for the unique characteristics of this expression system. The following systematic approach enables precise quantification and optimization:

  • Protoplast isolation and transfection: Implement standardized protocols for protoplast preparation using cellulase and driselase enzyme combinations, followed by PEG-mediated transfection of expression constructs .

  • Dual-reporter normalization system: To control for variation in transfection efficiency between samples, employ a dual-reporter system. Specifically, co-transfect with a second reporter (e.g., mCherry under 2x 35S promoter control) to provide an internal standard for normalization .

  • Plate reader-based fluorescence quantification: For high-throughput and objective measurement, quantify fluorescence intensity of living protoplasts using a plate reader system. This approach allows measurement of large numbers of samples under standardized conditions .

  • Time-course analysis: Monitor expression at multiple timepoints (e.g., 2, 4, 7, and 9 days post-transfection) to determine the optimal harvest time for different protein targets .

  • Microscopy validation: Complement quantitative measurements with fluorescence microscopy to assess cellular localization and expression patterns, which is particularly important when using targeting signals such as the aspartic protease signal peptide (APsp) .

  • Protein extraction and Western blot analysis: For definitive validation and quantification of full-length protein, implement protein extraction protocols optimized for Physcomitrella followed by Western blot analysis using appropriate antibodies .

This integrated approach has been successfully applied to evaluate the expression of complex proteins, including challenging targets such as spider silk proteins, demonstrating its robust applicability across diverse recombinant proteins .

How does the unique RAD51 gene organization in Physcomitrella patens impact recombination-based genetic engineering?

The organization of RAD51 genes in Physcomitrella patens presents distinctive features that directly influence recombination-based genetic engineering approaches. Physcomitrella contains two highly homologous but distinct RAD51 genes (PpRAD51A and PpRAD51B), which is unusual among eukaryotes and suggests a recent genome duplication event in its evolutionary history . The most striking characteristic of these genes is their intronless structure, which contrasts sharply with RAD51 genes from other multicellular eukaryotes that typically contain multiple introns . This unusual genetic organization has significant implications for genetic engineering applications:

  • Enhanced homologous recombination efficiency: The specialized RAD51 apparatus likely contributes to Physcomitrella's exceptionally high rate of homologous recombination, which can be leveraged for precise gene targeting with efficiencies up to 100 times higher than in flowering plants .

  • Methodology for targeted integration: When designing targeting constructs, researchers should consider the unique recombination machinery by including longer homology arms (typically 500-1000 bp) to maximize targeting efficiency .

  • Genome stability considerations: The duplicated RAD51 genes may provide functional redundancy in DNA repair pathways, potentially affecting the stability of integrated transgenes. Experimental designs should include thorough stability testing across multiple generations .

  • Specialized experimental approaches: To fully exploit this unusual recombination machinery, researchers can implement specialized transformation protocols that capitalize on the intronless nature of the RAD51 genes, potentially simplifying construct design by eliminating the need for intron inclusion in certain applications .

The unique organization of RAD51 genes represents both an advantage for genetic manipulation and a fascinating subject for evolutionary studies of recombination machinery in lower plants .

What role does RECA2 play in maintaining chloroplast genome stability during recombinant protein expression?

RECA2, a nuclear-encoded chloroplast-localized homolog of bacterial RecA recombinase, serves a critical dual function in maintaining chloroplast genome stability in Physcomitrella patens. Understanding this role is essential when utilizing chloroplast-targeted expressions systems, as it directly impacts transgene stability and expression levels. Research has revealed the following key aspects of RECA2 function:

  • DNA damage repair: RECA2 plays an essential role in the repair of damaged chloroplast DNA (cpDNA). Complete knockout of RECA2 results in low recovery of cpDNA from chemical damage (such as methyl methanesulfonate treatment), indicating impaired repair mechanisms .

  • Suppression of aberrant recombination: RECA2 actively suppresses undesirable recombination between short dispersed repeats (13-63 bp) in the chloroplast genome. In its absence, elevated levels of abnormal recombination products are observed, leading to chloroplast genome instability .

  • Maintenance of cpDNA copy number: RECA2 knockout mutants exhibit reduced cpDNA copy numbers, suggesting its role in cpDNA replication or stability .

  • Stress response: RECA2 is particularly important under stress conditions, with knockout mutants showing heightened sensitivity to DNA-damaging agents such as methyl methanesulfonate and UV radiation .

These findings have important methodological implications for chloroplast engineering and recombinant protein expression:

  • When designing chloroplast transformation vectors, researchers should avoid including short repetitive sequences that might promote aberrant recombination in the absence of full RECA2 function .

  • For stable long-term expression of recombinant proteins, monitoring RECA2 expression levels may serve as an indicator of chloroplast genome stability .

  • In experimental designs involving stress conditions or DNA-damaging treatments, potential impacts on RECA2 function and consequently on recombinant protein expression should be carefully considered .

The dual role of RECA2 highlights the complex molecular machinery maintaining chloroplast genome integrity, which directly impacts the stability and efficiency of chloroplast-based recombinant protein production systems.

How can Physcomitrella patens be optimized for the production of complex recombinant proteins requiring specific post-translational modifications?

Physcomitrella patens offers unique capabilities for producing recombinant proteins with specific post-translational modifications, particularly regarding N-glycosylation patterns. To fully leverage these capabilities, researchers can implement the following methodological approaches:

  • Glycoengineering strategy: Utilize targeted knockout of genes responsible for plant-specific glycosylation, including those encoding β1,2-xylosyltransferase, α1,3-fucosyltransferase, and β1,3-galactosyltransferase. This approach has successfully eliminated plant-specific β1,2-xylosylation, α1,3-fucosylation, β1,3-galactosylation, and Lewis A epitopes on N-glycans .

  • Glycosylation site modification: When designing recombinant proteins, analyze and potentially modify N-glycosylation sites to ensure optimal occupancy and processing. This can be accomplished through site-directed mutagenesis of the coding sequence .

  • Sialylation pathway engineering: For proteins requiring terminal sialic acid residues (critical for many therapeutic glycoproteins), introduce enzymes necessary for sialic acid synthesis, activation, and linkage to protein N-glycans, as this pathway is naturally absent in plants .

  • Subcellular targeting optimization: Utilize specific signal peptides, such as the aspartic protease signal peptide (APsp), to direct recombinant proteins to appropriate subcellular compartments for optimal folding and post-translational modifications .

  • Expression cassette design for complex proteins: For multi-domain or repetitive proteins (such as spider silk proteins), implement specialized expression vectors combining optimized promoters (such as the lhcsr1 promoter), codon-optimized coding sequences, and efficient terminators .

This systematic approach has enabled the successful production of complex human proteins in Physcomitrella, including erythropoietin and factor H (150 kDa), demonstrating the feasibility of producing pharmaceutically relevant proteins with appropriate post-translational modifications .

What are the comparative advantages of the lhcsr1 promoter versus other commonly used promoters for specific research applications?

The lhcsr1 promoter offers distinct advantages compared to conventional promoters used in plant biotechnology, with specific benefits depending on the research application. A systematic comparative analysis reveals the following advantages and methodological considerations:

Table 1: Comparative Performance of lhcsr1 Promoter versus Common Alternatives

PromoterRelative StrengthOriginSizeSpecial FeaturesBest Applications
lhcsr1>2x higher than 35SEndogenous (P. patens)677 bp (optimized)Light-responsiveRecombinant protein production, reporter gene expression
2x 35SModerateViral (CaMV)~800 bpConstitutiveGeneral expression, control vector
Rice actin1ModeratePlant (rice)~1.3 kbConstitutiveMonocot expression systems

When implementing the lhcsr1 promoter, researchers should consider the following methodological approaches:

  • Quantitative comparison protocol: For accurate assessment of promoter strength, utilize a dual-reporter system with fluorescence normalization. Specifically, transfect protoplasts with promoter:GFP fusion constructs and use mCherry under 2x 35S promoter as a normalization control .

  • Application-specific selection: The lhcsr1 promoter demonstrates superior performance for high-level expression of recombinant proteins, showing more than twofold higher expression levels compared to the commonly used 2x 35S promoter or rice actin1 promoter .

  • Size optimization strategy: When vector capacity is limited, implement the shortened 677 bp version of the lhcsr1 promoter, which maintains full activity while reducing construct size .

  • Synergistic enhancement approach: For maximum expression efficiency, combine the lhcsr1 promoter with codon-optimized coding sequences, which has been demonstrated to yield up to sixfold increased fluorescence signal compared to standard configurations .

The superior performance of the lhcsr1 promoter makes it particularly valuable for applications requiring high-level protein expression, including the production of therapeutic proteins, industrial enzymes, or fluorescent reporters for sensitive detection assays .

How can terminator selection impact recombinant protein expression levels in Physcomitrella patens?

Terminator sequences play a crucial but often overlooked role in optimizing recombinant protein expression in Physcomitrella patens. Recent research has illuminated the significant impact of terminator selection on gene expression levels and stability. The following methodological approach addresses terminator optimization:

  • Genomic analysis approach: The Physcomitrella genome contains 53,346 unique 3′UTRs (untranslated regions), with 7,964 transcripts containing at least one intron. Over 91% of 3′UTRs exhibit more than one polyadenylation site, indicating the prevalence of alternative polyadenylation .

  • Terminator selection methodology: From the complete set of 3′UTRs, select terminator candidates based on specific criteria including length, presence of regulatory elements, and association with highly expressed genes .

  • Validation using Dual-Luciferase assays: Implement transient Dual-Luciferase assays to characterize and compare terminator performance. This approach has successfully identified endogenous terminators that perform equally well as established heterologous terminators such as CaMV35S, AtHSP90, and NOS .

  • Double terminator strategy: For enhanced expression, test selected high-performing terminators in double terminator configurations. The impact on reporter levels depends on both terminator identity and positioning within the construct .

  • Integration with other regulatory elements: For optimal expression, combine selected terminators with strong promoters (such as lhcsr1) and codon-optimized coding sequences to create fully optimized expression cassettes .

This comprehensive approach to terminator selection provides researchers with additional tools to fine-tune gene expression beyond the traditional focus on promoters and codon optimization, potentially yielding substantial improvements in recombinant protein production efficiency .

What are the most common causes of expression variability in Physcomitrella patens, and how can they be mitigated?

Expression variability in Physcomitrella patens recombinant protein production can significantly impact experimental reproducibility and protein yield. Understanding and addressing the sources of this variability requires a systematic approach:

  • Transfection efficiency variability: Inconsistent protoplast preparation and transformation represent major sources of expression variability. To mitigate this:

    • Implement standardized protoplast isolation protocols with carefully controlled enzyme concentrations and digestion times

    • Utilize dual-reporter systems with a second reporter (e.g., mCherry under 2x 35S promoter control) for normalization across experiments

    • Maintain consistent PEG concentration and incubation times during transformation

  • Genetic position effects: Random integration of transgenes can lead to position effects affecting expression levels. Solutions include:

    • Target integration to specific loci with known expression characteristics using homologous recombination

    • Screen multiple transformant lines to identify those with optimal and stable expression

    • Consider including chromatin boundary elements in the construct design to insulate from position effects

  • Homologous recombination variability: Despite high efficiency, homologous recombination can exhibit variability. Approaches to improve consistency include:

    • Utilize longer homology arms (500-1000 bp) to maximize targeting efficiency

    • Verify correct integration using both PCR screening and Southern blot analysis

    • Consider the unique RAD51 gene organization in Physcomitrella when designing targeting strategies

  • Chloroplast genome instability: For chloroplast-targeted expressions, RECA2 function impacts stability. Strategies include:

    • Monitor RECA2 expression levels as an indicator of chloroplast genome stability

    • Avoid inclusion of short repetitive sequences in chloroplast transformation vectors

    • Implement regular testing for genome stability throughout extended cultivation periods

By systematically addressing these variables, researchers can significantly improve the reproducibility and reliability of recombinant protein expression in Physcomitrella patens.

How can researchers optimize protocols for large-scale purification of chlorophyll a-b binding proteins from Physcomitrella patens?

Purification of recombinant chlorophyll a-b binding proteins from Physcomitrella patens presents unique challenges due to their membrane association and pigment binding properties. A comprehensive purification strategy involves several critical methodological considerations:

  • Cultivation optimization:

    • Implement standardized bioreactor cultivation with controlled light intensity, temperature, and media composition

    • Determine optimal harvest timing based on expression kinetics, typically monitoring at multiple timepoints (2, 4, 7, and 9 days post-induction)

    • Consider photobioreactor systems that maintain consistent light exposure across the culture volume

  • Extraction protocol development:

    • Utilize mechanical disruption methods optimized for Physcomitrella tissue (e.g., high-pressure homogenization)

    • Implement differential centrifugation to isolate chloroplast-enriched fractions

    • Select detergents carefully to solubilize membrane-associated proteins while maintaining native conformation (e.g., mild non-ionic detergents like n-dodecyl-β-D-maltoside)

  • Chromatographic purification strategy:

    • Implement initial capture using immobilized metal affinity chromatography (IMAC) if the recombinant protein contains an affinity tag

    • Follow with ion exchange chromatography to separate based on charge differences

    • Complete purification with size exclusion chromatography to achieve high purity and remove aggregates

  • Protein stability optimization:

    • Determine buffer composition that maintains protein stability and prevents aggregation

    • Consider addition of specific lipids or pigments that may be required for proper folding

    • Implement quality control testing including gel filtration analysis and dynamic light scattering

  • Scaling considerations:

    • Design linear scalable processes that maintain consistent protein quality across production scales

    • Implement automation where possible to improve reproducibility

    • Develop in-process analytical methods to monitor protein quality throughout purification

This systematic approach addresses the specific challenges associated with chlorophyll-binding proteins while leveraging the advantages of the Physcomitrella expression system for complex recombinant proteins.

What emerging genetic tools might further enhance Physcomitrella patens as a platform for recombinant protein production?

The continuous development of genetic tools presents exciting opportunities to further enhance Physcomitrella patens as a recombinant protein production platform. Several emerging approaches warrant investigation:

  • CRISPR/Cas9 genome editing applications:

    • Implement multiplexed gene editing for simultaneous modification of multiple glycosylation pathways

    • Develop inducible CRISPR systems for temporal control of gene expression

    • Utilize base editing and prime editing technologies for precise modifications without double-strand breaks

  • Next-generation promoter engineering:

    • Develop synthetic promoter libraries based on the lhcsr1 promoter architecture

    • Create inducible promoter systems with tight regulation and high expression capacity

    • Implement tissue-specific promoters for compartmentalized protein production

  • Alternative splicing manipulation:

    • Considering the unusual intronless nature of key recombination genes like RAD51 , engineer specialized intron structures to enhance mRNA processing and stability

    • Develop tools to control alternative splicing patterns to maximize productive transcript production

  • Chloroplast genome engineering:

    • Leverage RECA2 function to develop more stable chloroplast transformation systems

    • Create synthetic chloroplast genomes with optimized architecture for recombinant protein production

    • Develop tools for precise editing of the chloroplast genome using CRISPR-derived technologies

  • Advanced bioreactor systems:

    • Design specialized photobioreactors optimized for Physcomitrella cultivation

    • Implement real-time monitoring systems with feedback control for optimal protein production

    • Develop continuous production systems with integrated product recovery

These emerging tools and approaches represent promising avenues for further enhancing the already substantial capabilities of Physcomitrella patens as a platform for the production of complex recombinant proteins, particularly those requiring specific post-translational modifications.

How might understanding of chloroplast genome stability mechanisms inform next-generation chloroplast transformation strategies?

Recent insights into chloroplast genome stability mechanisms, particularly involving RECA2 function, provide a foundation for developing improved chloroplast transformation strategies in Physcomitrella patens. A forward-looking approach should consider:

  • Leveraging RECA2 function for enhanced stability:

    • Develop transformation vectors that include RECA2 overexpression cassettes to enhance repair of transformation-induced damage

    • Design constructs that avoid the short dispersed repeats (13-63 bp) that promote aberrant recombination in the absence of full RECA2 function

    • Implement screening systems to identify transformants with optimal RECA2 activity levels

  • Alternative DNA delivery methods:

    • Explore gentler DNA delivery systems that minimize chloroplast genome damage during transformation

    • Develop methodologies that synchronize transformation with natural DNA repair cycles

    • Implement microfluidic-based single-cell transformation techniques for precise delivery

  • Synthetic biology approach to chloroplast engineering:

    • Design synthetic chloroplast genome segments with optimized sequence architecture

    • Remove or relocate endogenous repetitive elements that might promote instability

    • Implement orthogonal recombination systems that operate independently of the native machinery

  • Integration with nuclear genome engineering:

    • Develop coordinated nuclear-chloroplast engineering strategies that optimize both compartments

    • Engineer nuclear-encoded factors that enhance chloroplast genome stability

    • Create synthetic regulatory circuits spanning both genomes for precise control of recombinant protein production

  • Advanced stability monitoring systems:

    • Implement reporter systems that provide real-time monitoring of chloroplast genome stability

    • Develop high-throughput screening methods to identify variants with enhanced stability

    • Create computational models to predict stability impacts of specific sequence modifications

These approaches, founded on the fundamental understanding of chloroplast genome stability mechanisms, offer pathways to significantly enhance the utility of chloroplast transformation for recombinant protein production in Physcomitrella patens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.