Recombinant Physcomitrella patens subsp. patens Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Physcomitrella patens subsp. patens Cytochrome b6-f Complex Subunit 4 (petD)

Physcomitrella patens subsp. patens Cytochrome b6-f complex subunit 4, commonly referred to as petD, is a vital component of the cytochrome b6-f complex found in the moss Physcomitrella patens . The cytochrome b6-f complex is a protein complex that mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) . It is also involved in cyclic electron flow .

Structure and Function of Cytochrome b6-f Complex

The cytochrome b6-f complex is a hetero-oligomeric membrane protein complex and a central component of the photosynthetic electron transport chain in oxygenic photosynthesis . This complex functions as plastoquinol-plastocyanin oxidoreductase and facilitates both linear and PSI cyclic electron flow . It also mediates proton translocation across the membrane and photosynthetic redox control of energy distribution between the two photosystems, as well as gene expression .

In flowering plants, the cytochrome b6-f complex consists of at least nine subunits and forms a dimer . PetD is one of the large subunits encoded in plastid chromosomes . The complex contains multiple subunits, including PetA (cytochrome f), PetB (cytochrome b6), PetC (Rieske iron-sulfur protein), and PetD (subunit IV) . These subunits bind to metallo-redox prosthetic groups, such as hemes f, bp, bn, and cn, as well as the 2Fe-2S Rieske iron-sulfur protein (ISP), which together form the redox core of the complex .

The Role of petD

PetD is a critical subunit of the cytochrome b6-f complex . Mutants lacking petD have defects in the accumulation of monocistronic petB and petD . PetD is essential for the proper assembly of the Cytochrome b6-f complex in higher plants, even though it is located peripherally in the complex .

Importance of petD in Physcomitrella patens

Physcomitrella patens, a moss, serves as a model system for studying plant defense responses and various aspects of plant biology . Research on Physcomitrella patens has shown that disrupting mitochondrial complex I (CI) affects photosynthesis, demonstrating the importance of metabolic interactions between organelles in energy usage . Additionally, P. patens activates cell wall reinforcement as a defense mechanism against pathogens like Botrytis cinerea .

Research Findings

StudyOrganismKey Findings
HCF152 BindingArabidopsis thalianaHCF152 binds to the psbH–petB intergenic region, stabilizing petB transcripts .
Cytochrome b6f ComplexM. laminosusThe b6f complex contains eight polypeptide subunits, including petA, petB, petC, and petD, which bind to redox prosthetic groups .
PetM FunctionArabidopsis thalianaPetM is essential for maintaining the function of the cytochrome b6f complex, likely stabilizing the core of the complex .
Complex I InactivationPhyscomitrium patensInactivation of mitochondrial Complex I alters photosynthesis, highlighting the importance of respiratory activity in photosynthesis .
Low-Molecular-Weight SubunitsArabidopsis thalianaLow-molecular-weight subunits PetL, PetG, and PetN are essential for proper assembly of the cytochrome b6f complex .
Cell Wall ReinforcementPhyscomitrella patensP. patens activates cell wall reinforcement upon infection with Botrytis cinerea, indicating defense responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
petD
Target Protein Sequence
MGVTKKPDLSDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTVGLAVLEPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMAAVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVSIWLGIGAALPIDISLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and characteristics of the petD gene in Physcomitrella patens?

The petD gene in Physcomitrella patens is located in the chloroplast genome, which is 122,890 bp in total size. This gene encodes subunit 4 of the cytochrome b6-f complex, a critical component of the photosynthetic electron transport chain. The petD gene in P. patens is particularly notable because it is involved in a unique 71 kb inversion ranging from petD to rpoB, which differentiates P. patens from other moss species and bryophytes . This genomic arrangement makes petD an important marker for evolutionary studies of land plants and a valuable target for recombinant research.

What is the functional role of the cytochrome b6-f complex subunit 4 in moss photosynthesis?

The cytochrome b6-f complex, of which petD encodes subunit 4, functions as a critical electron transfer intermediary between photosystems II and I in the photosynthetic electron transport chain. This complex couples electron transfer to proton translocation across the thylakoid membrane, contributing to the establishment of the proton gradient required for ATP synthesis. In P. patens, this function is particularly significant due to its evolutionary position as an early land plant, providing insights into the adaptation of photosynthetic mechanisms during the transition to terrestrial environments. The specific structural features of the petD gene product in P. patens may contribute to the moss's adaptability to variable light conditions in its natural habitat.

What are the most effective gene targeting techniques for manipulating the petD gene in P. patens?

The most effective approach for targeting the petD gene in P. patens leverages the moss's exceptionally high frequency of homologous recombination. For targeted gene replacement (TGR), researchers should design DNA constructs containing sequences homologous to the flanking regions of petD (typically 500-1000 bp on each side) . Transformation of these constructs into P. patens protoplasts allows for homologous recombination to occur, replacing the native petD with a recombinant version. The efficiency of this process can be improved by:

  • Optimizing the length of homologous sequences (longer sequences generally increase targeting efficiency)

  • Using linearized DNA constructs rather than circular plasmids

  • Including positive selection markers (e.g., antibiotic resistance) within the construct

  • Employing negative selection markers outside the homologous regions to select against random integration events

The dominant haploid phase of P. patens facilitates the screening process, as mutations can be directly observed without interference from wild-type alleles .

How can CRISPR-Cas9 technology be applied to modify petD in P. patens?

CRISPR-Cas9 technology provides a powerful alternative to traditional gene targeting for petD modification in P. patens. The methodology involves:

  • Designing single guide RNAs (sgRNAs) specific to the petD target sequence

  • Co-transforming P. patens protoplasts with plasmids expressing Cas9 and sgRNAs

  • Including donor DNA templates to direct homology-directed repair (HDR)

In P. patens, approximately 60% of CRISPR-Cas9 induced double-strand breaks (DSBs) are repaired via HDR, compared to the 54% efficiency of traditional gene targeting methods . For optimal results, researchers can use various forms of donor DNA templates, including:

Donor Template TypeAdvantagesTypical Efficiency
Single-strand DNA oligosEasy design, high efficiency for small modifications50-70%
Double-strand DNA oligosGreater stability, suitable for larger modifications40-60%
Linearized plasmidsAllows for larger insertions30-50%
Circular plasmidsReduced degradation in cells28-40%

The donor DNA template-assisted CRISPR-Cas9 method enables precise genome editing, resulting in 28-100% of colonies showing expected modifications including substitutions, deletions, and knock-in tagging at the petD locus .

What protoplast preparation protocols yield the highest transformation efficiency for petD manipulation?

For optimal transformation efficiency when targeting the petD gene, the protoplast preparation protocol should be meticulously followed:

  • Harvest 7-day-old P. patens protonema tissue grown on BCDAT medium under standard conditions (16/8 light/dark cycle at 25°C)

  • Digest the tissue in a solution containing 1% Driselase in 8% mannitol for 30-40 minutes at room temperature with gentle agitation

  • Filter the digested mixture through a 100μm mesh to remove undigested tissue

  • Centrifuge at 100g for 5 minutes and wash the protoplasts twice with 8% mannitol

  • Resuspend in MMM solution (8% mannitol, 15mM MgCl₂, 0.1% MES, pH 5.6)

  • Count protoplasts and adjust to 1.6 × 10⁶ protoplasts/ml

For transformation:

  • Mix 300μl of protoplasts with 20-30μg of linearized DNA construct

  • Add 300μl of PEG solution (40% PEG 4000, 0.1M Ca(NO₃)₂, 0.4M mannitol, pH 5.6)

  • Heat shock at 45°C for 5 minutes

  • Allow recovery at room temperature for 10 minutes

  • Gradually dilute with 8% mannitol over 30 minutes

  • Plate on BCDAT medium supplemented with 8% mannitol and appropriate antibiotics

This protocol typically yields transformation efficiencies of 70-80% for homologous recombination targeting the petD locus, significantly higher than those achieved for most other plant species.

How can one design experiments to investigate the evolutionary significance of the unique petD-containing inversion in P. patens?

To investigate the evolutionary significance of the unique 71 kb inversion containing petD in P. patens, a multi-faceted experimental approach is recommended:

  • Comparative genomic analysis:

    • Sequence and analyze the inversion boundary regions in P. patens and corresponding regions in multiple other moss species

    • Identify potential sequence motifs that might have facilitated the inversion event

    • Use bioinformatic tools to detect selection signatures across the inverted region

  • Synthetic biology approach:

    • Engineer P. patens strains where the inversion is "corrected" to match the arrangement in other mosses

    • Compare photosynthetic efficiency, growth rate, and stress responses between wild-type and engineered strains

    • Analyze transcriptomic and metabolomic profiles to identify pathways affected by the genomic rearrangement

  • Ecological fitness assessment:

    • Subject wild-type and "corrected" strains to various environmental conditions mimicking evolutionary pressures

    • Measure competitive fitness through mixed-culture experiments

    • Quantify differences in reproductive success and spore viability

This comprehensive approach can elucidate whether the inversion confers selective advantages or represents a neutral evolutionary event, providing insights into chloroplast genome evolution in land plants.

What techniques can be used to study the protein-protein interactions of recombinant petD gene products?

To elucidate the protein-protein interactions of recombinant petD gene products in P. patens, several complementary techniques should be employed:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Generate recombinant P. patens strains expressing petD with affinity tags (e.g., FLAG, His, or TAP tag)

    • Isolate thylakoid membranes and solubilize using mild detergents

    • Perform affinity purification followed by mass spectrometry to identify interacting partners

    • Compare interaction profiles between wild-type and mutant petD proteins

  • Split-GFP complementation assay:

    • Fuse the N-terminal fragment of GFP to petD and C-terminal fragments to candidate interacting proteins

    • Transform into P. patens protoplasts

    • Observe fluorescence reconstitution using confocal microscopy to confirm interactions in vivo

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE):

    • Extract chloroplast membrane complexes under native conditions

    • Separate complexes based on size while maintaining protein-protein interactions

    • Perform second-dimension SDS-PAGE to identify individual components

  • Förster resonance energy transfer (FRET):

    • Generate fusion constructs of petD with CFP and potential interacting partners with YFP

    • Measure energy transfer efficiency to quantify the strength and dynamics of interactions

These approaches provide complementary data on the composition, dynamics, and functional significance of protein complexes involving the petD gene product in the cytochrome b6-f complex.

How does the genetic background influence the efficiency of homologous recombination targeting petD?

The genetic background significantly impacts homologous recombination efficiency when targeting the petD locus in P. patens. Research has revealed several key factors:

  • DNA repair pathway components:

    • Strains with enhanced expression of RAD51, a key homologous recombination protein, show increased targeting efficiency (up to 1.5-fold)

    • Knockdown of key non-homologous end joining (NHEJ) factors like KU70/80 can shift repair pathway choice toward homologous recombination

  • Chromatin structure factors:

    • The condensation state of chromatin around the petD locus affects accessibility to recombination machinery

    • Treatment with histone deacetylase inhibitors (e.g., trichostatin A) during transformation can increase targeting efficiency by promoting open chromatin conformation

  • Cell cycle stage:

    • Synchronizing protoplasts in S/G2 phases before transformation increases homologous recombination efficiency

    • This can be achieved through treatment with specific cell cycle inhibitors followed by release

  • Strain differences:

    P. patens StrainTargeting Efficiency at petD locusNotes
    Gransden54-67%Standard laboratory strain
    Reute30-45%More robust growth but lower HR efficiency
    Villersexel K340-55%Greater genetic diversity

Researchers should consider these factors when designing experiments, potentially pre-screening for specific genetic backgrounds or modifying protocols based on the strain being used.

What are common pitfalls when analyzing petD recombinant lines, and how can they be avoided?

When analyzing petD recombinant lines in P. patens, researchers frequently encounter several challenges that can be mitigated with proper experimental design:

  • Off-target integration events:

    • Issue: Integration of the construct at non-target genomic locations

    • Detection: Perform Southern blot analysis using probes specific to the transgene

    • Prevention: Include negative selection markers outside homology regions and screen more colonies

  • Protoplast fusion during transformation:

    • Issue: Fusion of multiple protoplasts creating chimeric plants

    • Detection: Flow cytometry to identify abnormal DNA content; PCR genotyping of multiple tissue samples

    • Prevention: Reduce protoplast density during PEG-mediated transformation; careful isolation during regeneration

  • Targeted insertion (TI) instead of targeted replacement (TGR):

    • Issue: One end integrates via homologous recombination while the other via non-homologous end joining

    • Detection: PCR analysis of both 5' and 3' integration junctions

    • Prevention: Design longer homology arms; select transformants based on PCR confirmation of both junctions

  • Phenotypic inconsistencies:

    • Issue: Variable phenotypes among supposedly identical recombinant lines

    • Detection: Analyze multiple independent lines; perform RNA-seq to check for potential compensatory changes

    • Prevention: Generate and characterize at least three independent lines for each construct

  • Misinterpretation of photosynthetic defects:

    • Issue: Attribution of phenotypes to petD modification when they result from other factors

    • Detection: Complement the mutation by reintroducing wild-type petD

    • Prevention: Include appropriate controls; perform detailed photosynthetic parameter measurements

Rigorous molecular characterization of recombinant lines is essential before attributing phenotypes to petD modifications.

How can researchers resolve contradictory data about petD function from different experimental approaches?

When faced with contradictory data regarding petD function from different experimental approaches, researchers should implement a systematic resolution strategy:

  • Methodological validation:

    • Cross-validate findings using independent techniques (e.g., if spectroscopic and growth phenotypes conflict, verify both methods with known controls)

    • Reassess experimental conditions for potential variables affecting outcomes

    • Consider temporal factors, as some phenotypes may manifest differently across developmental stages

  • Integration of multi-omics data:

    • Combine transcriptomic, proteomic, and metabolomic analyses to build a comprehensive model

    • Identify pathway compensations that might explain apparently contradictory results

    • Develop network models incorporating potential feedback mechanisms

  • Genetic interaction analysis:

    • Generate double or triple mutants combining petD modifications with related genes

    • Perform epistasis analysis to position contradictory functions within biological pathways

    • Use inducible or tissue-specific modifications to dissect temporal or spatial roles

  • Systematic data reconciliation framework:

    Contradiction TypeResolution ApproachExample
    Functional vs. phenotypicMeasure intermediate steps in the pathwayMeasure electron transport rates between conflicting growth and proteomics data
    In vitro vs. in vivoTest gradient of conditions bridging the approachesVary membrane composition to match physiological state
    Genetic vs. biochemicalCreate separation-of-function mutationsDesign specific amino acid substitutions affecting only one function
    Strain-dependentPerform reciprocal gene transfersIntroduce Gransden petD into Reute background and vice versa
  • Mathematical modeling:

    • Develop quantitative models incorporating contradictory data points

    • Identify parameter ranges where all data can be reconciled

    • Use model predictions to design experiments specifically targeting the contradiction

This structured approach transforms contradictions from obstacles into opportunities for deeper mechanistic insights.

What statistical approaches should be used when comparing wild-type and recombinant petD phenotypes?

  • Experimental design considerations:

    • Use multiple independent transgenic lines (minimum 3-5) for each construct

    • Include proper controls: wild-type, empty vector transformants, and known photosynthetic mutants

    • Perform biological replicates (n ≥ 3) and technical replicates within each experiment

  • Parametric vs. non-parametric approaches:

    • Test data for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • For normally distributed data: t-tests (two groups) or ANOVA with post-hoc tests (multiple groups)

    • For non-normal data: Mann-Whitney U (two groups) or Kruskal-Wallis with Dunn's post-hoc (multiple groups)

  • Multivariate analysis for complex phenotypes:

    • Principal Component Analysis (PCA) to identify patterns in multidimensional phenotypic data

    • MANOVA when multiple dependent variables are being measured simultaneously

    • Hierarchical clustering to identify groups of similar phenotypes among different recombinant lines

  • Specialized analyses for photosynthetic parameters:

    ParameterStatistical ApproachSignificance Threshold
    Chlorophyll fluorescenceRepeated measures ANOVAp < 0.05 with Bonferroni correction
    P700 oxidation kineticsNon-linear regression comparisonExtra sum-of-squares F test
    Growth rateLinear mixed modelsp < 0.05 with random effects
    Electron transport rateTwo-way ANOVA (genotype × light intensity)p < 0.05 with Tukey's HSD
  • Power analysis:

    • Perform a priori power analysis to determine sample size needed to detect expected effect sizes

    • For subtle phenotypes, increase sample size to maintain statistical power above 0.8

  • Effect size reporting:

    • Always report effect sizes (Cohen's d, η², etc.) alongside p-values

    • Use confidence intervals to indicate precision of measurements

What are the most promising applications of petD engineering for studying chloroplast evolution?

Engineering the petD gene in P. patens offers several promising avenues for studying chloroplast evolution:

  • Synthetic evolutionary recapitulation:

    • Introducing petD sequences from diverse photosynthetic organisms (cyanobacteria to angiosperms) into P. patens

    • Testing functional compatibility across evolutionary distances

    • Identifying critical amino acid changes that correspond to major evolutionary transitions

    • Creating a timeline of functional innovations in the cytochrome b6-f complex

  • Ancestral sequence reconstruction:

    • Computationally inferring ancestral petD sequences at key evolutionary nodes

    • Engineering P. patens to express these reconstructed sequences

    • Measuring fitness under conditions mimicking ancient environments

    • Testing hypotheses about the adaptive significance of historical sequence changes

  • Horizontal gene transfer exploration:

    • Investigating the biological consequences of rare horizontal gene transfer events involving petD

    • Engineering chimeric petD genes combining domains from different lineages

    • Assessing the functional impacts on electron transport and photosynthetic efficiency

  • Evolutionary constraints mapping:

    • Using saturation mutagenesis to identify functionally constrained regions of petD

    • Correlating conservation patterns with structural and functional requirements

    • Developing models of coevolution between petD and interacting proteins

These approaches can provide unprecedented insights into the molecular mechanisms underlying chloroplast evolution and the adaptation of photosynthesis across diverse lineages and environmental conditions.

How might advanced imaging techniques enhance our understanding of recombinant petD proteins?

Advanced imaging techniques can substantially enhance our understanding of recombinant petD proteins in P. patens:

  • Super-resolution microscopy:

    • Stimulated emission depletion (STED) microscopy can visualize cytochrome b6-f complex organization within thylakoid membranes at 20-30 nm resolution

    • Single-molecule localization microscopy (PALM/STORM) can track individual labeled petD proteins to reveal dynamics and clustering behavior

    • Structured illumination microscopy (SIM) can examine the spatial relationship between cytochrome b6-f complexes and other photosynthetic components

  • Cryo-electron microscopy (cryo-EM):

    • Direct visualization of recombinant cytochrome b6-f complex structures at near-atomic resolution

    • Comparison of wild-type and engineered complex structures to understand functional modifications

    • Analysis of conformational states during electron transport

  • Live-cell imaging approaches:

    • FRET-based biosensors to monitor electron transfer in real-time

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility within thylakoid membranes

    • Light-sheet microscopy for long-term, low-phototoxicity observation of chloroplast dynamics

  • Correlative light and electron microscopy (CLEM):

    • Combining fluorescence microscopy of tagged petD with high-resolution ultrastructural analysis

    • Linking protein localization to membrane architecture and organization

  • Label-free imaging techniques:

    • Second harmonic generation microscopy to visualize membrane potential changes

    • Raman microscopy for chemical composition analysis without fluorescent tags

These advanced imaging approaches can bridge structure-function relationships of recombinant petD proteins, providing insights into how molecular modifications translate to changes in organization, dynamics, and function within the living chloroplast.

What potential does petD research in P. patens hold for addressing fundamental questions in photosynthesis research?

Research on petD in P. patens holds significant potential for addressing several fundamental questions in photosynthesis:

  • Proton-coupled electron transfer mechanisms:

    • Engineering specific amino acid substitutions in the petD protein to alter the properties of the Q cycle

    • Investigating the molecular basis of proton translocation coupled to electron transfer

    • Developing a comprehensive biophysical model of proton-electron coupling in the cytochrome b6-f complex

  • Evolutionary adaptation of electron transport chains:

    • Comparing the efficiency and regulatory properties of cytochrome b6-f complexes across evolutionary lineages

    • Identifying adaptations that allowed early land plants to cope with fluctuating light environments

    • Testing hypotheses about the co-evolution of photosystems I and II with the connecting cytochrome b6-f complex

  • Synthetic biology approaches to photosynthesis enhancement:

    • Engineering petD variants with altered kinetic properties to potentially enhance electron transport rates

    • Developing cytochrome b6-f complexes with reduced susceptibility to photoinhibition

    • Creating variants that optimize performance under specific environmental conditions

  • Stress response integration:

    • Investigating the role of the cytochrome b6-f complex as a sensor of cellular energy status

    • Elucidating the communication between chloroplast electron transport and nuclear gene expression

    • Developing moss lines with enhanced resilience to environmental stressors

  • Alternative electron flow pathways:

    • Using petD variants to manipulate cyclic electron flow around photosystem I

    • Understanding the balance between linear and cyclic electron transport under various conditions

    • Examining the role of cytochrome b6-f in photoprotection mechanisms

This research has fundamental significance and potential applications in enhancing photosynthetic efficiency in both model systems and crop plants, contributing to sustainable agriculture and bioenergy production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.