Recombinant Physcomitrella patens subsp. patens Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant petB is typically produced in Escherichia coli using plasmid vectors with N-terminal His-tags for affinity chromatography .

Key Production Parameters:

ParameterDetail
Expression SystemE. coli BL21(DE3) or similar strains
InductionIPTG induction at OD₆₀₀ ≈ 0.6
PurificationNi-NTA affinity chromatography followed by size-exclusion chromatography
Yield~1.5 mg per liter of culture (varies with optimization)
Purity>90% (SDS-PAGE verified)

Sources:

Functional Insights

  • Role in Photosynthesis: PetB is a core subunit of the cytochrome b6f complex, mediating electron transfer between photosystem II and I while contributing to proton gradient generation .

  • RNA Editing Dependency: In P. patens, petB transcript maturation requires DYW-class pentatricopeptide repeat (PPR) proteins for RNA editing at specific mitochondrial sites .

  • Evolutionary Conservation: Structural homology with Marchantia polymorpha and Spirogyra maxima cytochrome b6 highlights conserved functional domains across plant lineages .

Applications in Research

  • ELISA Development: Utilized as an antigen in immunological assays due to its high solubility and stability .

  • Photosynthesis Studies: Serves as a model protein for investigating electron transport mechanisms in non-vascular plants .

  • Biotechnological Tool: P. patens's efficient homologous recombination system enables precise genomic integration of petB variants for metabolic engineering .

Technical Notes

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C; avoid repeated freeze-thaw cycles .

  • Activity Assays: Redox activity measured via spectrophotometric analysis at 563 nm (reduced cytochrome b6) .

Comparative Analysis with Other Species

FeatureP. patens petBMicrocystis aeruginosa petBSpirogyra maxima petB
Length (aa)215222215
Expression HostE. coliE. coliE. coli
TagHis-tagHis-tagHis-tag
UniProt IDQ6YXN2B0JM94Q71KP4

Sources:

Challenges and Innovations

  • Low Native Expression: Native petB in P. patens requires codon optimization for high-yield recombinant production .

  • Thermostability: Engineered variants with improved thermal stability are under development for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
petB
Target Protein Sequence
MGRVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVEILRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What makes Physcomitrella patens an advantageous model for recombinant protein expression?

Physcomitrella patens offers several unique advantages for recombinant protein production. This non-vascular plant has gained significant attention following the discovery that homologous recombination occurs with remarkable efficiency in its genome. This characteristic makes P. patens exceptionally valuable not only for studying gene function but also for producing recombinant proteins with precision. The system provides advantageous attributes for molecular farming including protein production in cell suspension, the capability to generate targeted knockout mutants for glycoengineering, and quantitative optimization parameters for protein production. In terms of technical advancement, P. patens represents one of the most sophisticated plant expression systems available and serves as a promising alternative to animal cell factories for producing therapeutic proteins with either simple or highly complex structures .

What is the role of Cytochrome b6 (petB) in Physcomitrella patens?

Cytochrome b6, encoded by the petB gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Physcomitrella patens. This protein complex mediates electron transfer between Photosystem II and Photosystem I, contributing to the proton gradient necessary for ATP synthesis. In P. patens, as in other photosynthetic organisms, the cytochrome b6f complex consists of multiple subunits that work together to facilitate proper electron flow. The assembly and stability of this complex, including the proper incorporation of Cytochrome b6, are regulated by various factors including pentatricopeptide repeat (PPR) proteins that influence transcript stability and processing .

What is the genetic structure of the petB gene in Physcomitrella patens?

The petB gene in Physcomitrella patens is located in the chloroplast genome. Following the genome sequencing of P. patens in 2007, which revealed a genome size of 511 Mb with 27 pseudochromosomes, comparative genomic studies have shown that P. patens shares significant homology with higher plants. More than 66% of Arabidopsis thaliana proteins have homologs in P. patens, including those involved in photosynthetic processes . The petB gene specifically encodes a protein with multiple transmembrane domains that anchors within the thylakoid membrane, forming part of the essential cytochrome b6f complex required for photosynthetic electron transport.

What growth conditions are optimal for Physcomitrella patens cultures when studying photosynthetic proteins?

For optimal cultivation of Physcomitrella patens when studying photosynthetic proteins such as Cytochrome b6, the following conditions are recommended:

ParameterStandard ConditionAlternative Condition
MediumBCD with 5 mM ammonium tartrate (BCDAT)BCDAT with 0.5% glucose
Temperature25°C20-27°C
Photoperiod16-hour light / 8-hour darkContinuous light for specific experiments
Light Intensity50-80 μmol m⁻² s⁻¹Up to 100 μmol m⁻² s⁻¹ for high light studies
Culture TypeSolid media for protonemataLiquid suspension for protein production
Growth Duration7-30 days depending on experimental needs7 days for proteomics and molecular analyses

These conditions can be adjusted based on specific experimental requirements. For studies focusing on photosynthetic efficiency and cytochrome function, researchers should carefully control light conditions to ensure reproducible results.

How do Photosystem II components interact with Cytochrome b6 in Physcomitrella patens?

In Physcomitrella patens, the interaction between Photosystem II components and Cytochrome b6 involves a coordinated electron transport chain. The PsbF subunit of Photosystem II, also known as cytochrome b559β, is particularly relevant as it is a small subunit tightly associated with the reaction center of Photosystem II. This subunit plays a protective role by functioning as an electron acceptor or donor . Electrons from Photosystem II are transferred to plastoquinone, which subsequently delivers them to the cytochrome b6f complex containing Cytochrome b6. This electron transfer process is crucial for maintaining the proton gradient across the thylakoid membrane needed for ATP synthesis. The assembly and stability of these interactions are regulated by various factors, including specific proteins that influence the maturation and stabilization of the transcript encoding these photosynthetic components .

What are the comparative advantages of gene targeting versus CRISPR-Cas9 for modifying petB in Physcomitrella patens?

When modifying the petB gene in Physcomitrella patens, researchers have two primary options: traditional gene targeting and CRISPR-Cas9 technology. Each approach has distinct advantages:

For petB modification specifically, CRISPR-Cas9 with donor DNA templates offers precise control through homology-directed repair, leveraging P. patens' natural high frequency of homologous recombination. This approach can generate not only knockouts but also knock-in lines and specific substitutions, which is particularly valuable for studying essential genes like petB .

How can researchers optimize protoplast transformation for recombinant petB studies?

Optimizing protoplast transformation is crucial for successful recombinant Cytochrome b6 studies in Physcomitrella patens. The following methodological considerations should be implemented:

  • Protoplast Isolation: Harvest 7-day-old protonema tissues grown in liquid BCDAT medium for optimal protoplast isolation. Digest cell walls using a combination of driselase, cellulase, and pectolyase enzymes in an isotonic solution.

  • DNA Preparation: For gene targeting, use linearized DNA with homology arms of at least 500 bp flanking the selection marker. For CRISPR-Cas9, co-transform plasmids harboring Cas9 and sgRNAs specific to petB, along with donor DNA templates if precise editing is desired.

  • Transformation Protocol: Use PEG-mediated transformation with a PEG concentration of 25-30%. The optimal DNA:protoplast ratio is typically 10-20 μg DNA per 10⁶ protoplasts.

  • Recovery Medium: Immediately after transformation, place protoplasts in regeneration medium containing mannitol as an osmotic stabilizer and allow cell wall regeneration for 5-7 days.

  • Selection Strategy: Apply appropriate selection pressure (typically antibiotic selection) after cell wall regeneration to identify transformants.

  • Regeneration Efficiency: Monitor for protoplast fusion during regeneration, as this can lead to polyploid tissues that complicate genetic analysis .

To prevent common issues like protoplast fusion and poor regeneration, maintain proper cell density and ensure gentle handling throughout the process. For petB studies specifically, consider using inducible promoters if complete knockout might be lethal due to the essential nature of Cytochrome b6 in photosynthesis.

What base editing approaches are most effective for introducing point mutations in petB?

For introducing precise point mutations in the petB gene of Physcomitrella patens, CRISPR-Cas9 deaminase systems have shown remarkable effectiveness. Two particularly successful approaches are:

  • Cytosine Base Editing (CBE): This system uses nCas9 (D10A) fused with cytosine deaminase from Petromyzon marinus, driven by the pcUbi4-2 promoter. The CBE system can achieve up to 89% efficiency in introducing C-to-T conversions within a predictable editing window approximately 14-20 base pairs upstream from the PAM site.

  • Adenine Base Editing (ABE): This approach employs nCas9 fused with a heterodimer of wild-type and mutated E. coli tRNA adenosine deaminase, driven by the OsAct1 promoter. The ABE system has demonstrated 100% efficiency in some target sequences for A-to-G base editing within the same predictable window.

Both systems allow for multiplex editing of up to four targets simultaneously, which is particularly valuable for studying gene families or multiple sites within the petB gene. The precise base editing eliminates the need for donor DNA templates while still achieving high specificity. For studying Cytochrome b6 function, these approaches allow researchers to introduce specific amino acid changes to examine structure-function relationships without disrupting the entire gene .

How do PPR proteins regulate petB transcript stability and translation in Physcomitrella patens?

Pentatricopeptide repeat (PPR) proteins play crucial roles in regulating chloroplast gene expression in Physcomitrella patens, including the petB gene encoding Cytochrome b6. These sequence-specific RNA-binding proteins influence multiple aspects of RNA metabolism, including:

  • Transcript Stabilization: PPR proteins bind to specific sequences within the 5' or 3' untranslated regions of the petB transcript, protecting it from exonucleolytic degradation. Similar to the mechanism observed with MCA1 (PPR14) binding to petA mRNA, which protects it from degradation by exonucleases and facilitates cytochrome f synthesis .

  • RNA Processing: Some PPR proteins are involved in the processing of polycistronic transcripts that include petB, ensuring proper splicing of introns and generation of mature, translation-competent mRNAs.

  • Translation Activation: Certain PPR proteins directly promote translation initiation by interacting with the ribosome or translation factors specifically for petB and other photosynthetic transcripts.

  • RNA Editing: In plant organelles, PPR proteins mediate C-to-U RNA editing, which can alter the coding sequence of petB and affect the structure and function of Cytochrome b6.

The regulatory network is complex, with different PPR proteins potentially having redundant or complementary functions. Advanced research in this area focuses on identifying the specific PPR proteins that interact with petB transcripts and characterizing their binding sites and mechanisms of action through techniques like RNA immunoprecipitation coupled with sequencing (RIP-seq) .

What approaches can resolve integration challenges when targeting the chloroplast genome for petB modifications?

Targeting the chloroplast genome for petB modifications presents unique challenges due to the multiple copies of the chloroplast genome within each cell. Researchers can overcome these challenges using the following advanced approaches:

  • Chloroplast-Specific Transformation Vectors: Design vectors with chloroplast-specific promoters and terminators flanking the modified petB gene and selection marker. The most effective vectors include homology arms of 800-1500 bp for efficient recombination.

  • Selection Pressure Optimization: Apply sustained selection pressure to achieve homoplasmy (uniform modification of all chloroplast genome copies). This typically requires multiple rounds of selection on increasing concentrations of the selective agent.

  • Southern Blot Analysis: Implement rigorous molecular characterization using Southern blotting to confirm complete integration and homoplasmy, distinguishing between nuclear and chloroplast integration events.

  • Chloroplast CRISPR Systems: Utilize chloroplast-targeted CRISPR-Cas9 systems where the Cas9 protein contains a chloroplast transit peptide, allowing direct editing within the organelle. This approach can be combined with donor templates for precise modification of petB.

  • Plastid Mutator Systems: For specific applications, consider using plastid mutator systems that increase the frequency of point mutations specifically within the chloroplast genome, followed by screening for desired petB variants.

The choice of approach depends on the specific modification desired, with point mutations being more amenable to CRISPR-based strategies and larger modifications or replacements better suited to traditional chloroplast transformation techniques using homologous recombination .

How can researchers differentiate between direct and indirect effects when analyzing phenotypes of petB mutants?

Differentiating between direct and indirect effects in petB mutants requires sophisticated experimental designs and controls:

  • Complementation Studies: Reintroduce the wild-type petB gene under an inducible promoter in the mutant background. If the phenotype is rescued upon induction, it confirms the direct relationship between petB modification and the observed phenotype.

  • Site-Directed Mutagenesis Series: Create a series of mutations affecting different functional domains of Cytochrome b6. Correlation between specific domain alterations and phenotypic changes can reveal direct structure-function relationships.

  • Metabolomic Profiling: Comprehensive analysis of metabolite changes in petB mutants compared to wild-type can reveal primary (direct) versus secondary metabolic adjustments.

  • Time-Course Analysis: Monitor phenotypic changes over time following inducible petB modification. Immediate changes are more likely to represent direct effects, while changes appearing later may indicate secondary adaptations.

  • Transcriptomic Analysis: RNA-seq comparing petB mutants with wild-type can identify differentially expressed genes. Pathway enrichment analysis can then separate primary responses from compensatory mechanisms.

  • Electron Transport Chain Analysis: Direct measurement of electron transport rates at different segments of the photosynthetic electron transport chain can pinpoint where specific defects occur in petB mutants.

  • Epistasis Analysis: Generate double mutants affecting both petB and genes in potentially related pathways. The pattern of genetic interaction can reveal functional relationships and distinguish direct from indirect effects .

What spectroscopic techniques are most informative for characterizing recombinant Cytochrome b6 function?

For comprehensive characterization of recombinant Cytochrome b6 function in Physcomitrella patens, researchers should employ the following spectroscopic techniques:

  • Absorption Spectroscopy: Measures the characteristic absorption peaks of Cytochrome b6 in its oxidized (563 nm) and reduced (553 nm and 563 nm) states. This technique provides information about the redox state and concentration of the cytochrome.

  • Circular Dichroism (CD) Spectroscopy: Analyzes the secondary structure of the recombinant Cytochrome b6 protein, confirming proper folding and structural integrity compared to the native protein.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Detects unpaired electrons in the heme groups of Cytochrome b6, providing detailed information about the electronic structure and coordination environment of the iron centers.

  • Fluorescence Spectroscopy: Measures chlorophyll fluorescence parameters like Fv/Fm (maximum quantum yield of PSII) and ΦPSII (effective quantum yield), which indirectly assess electron transport through the cytochrome b6f complex.

  • Time-Resolved Absorption Spectroscopy: Tracks the kinetics of electron transfer through Cytochrome b6 with microsecond to millisecond resolution, revealing rate-limiting steps in the electron transport chain.

When applying these techniques, researchers should always include appropriate controls, such as wild-type samples and known mutants with characterized defects in photosynthetic electron transport. For the most comprehensive analysis, combine multiple spectroscopic approaches to build a complete picture of Cytochrome b6 structure and function in both native and recombinant contexts.

How can researchers optimize yield and stability of recombinant Cytochrome b6 in Physcomitrella patens?

Optimizing yield and stability of recombinant Cytochrome b6 in Physcomitrella patens requires attention to several methodological factors:

  • Promoter Selection: Utilize strong, tissue-specific promoters for targeted expression. The moss actin promoter (PpAct1) provides high constitutive expression, while the moss heat shock protein promoter (PpHSP) offers inducible expression for potentially toxic proteins.

  • Codon Optimization: Adapt the coding sequence to P. patens codon usage preferences to enhance translation efficiency. This is particularly important for recombinant proteins that may contain codons rarely used in moss.

  • Signal Peptides and Tags: Include appropriate targeting signals to direct the recombinant Cytochrome b6 to the chloroplast. Consider adding purification tags that do not interfere with protein folding or function.

  • Growth Conditions Optimization:

ParameterStandard ConditionOptimized for Protein Production
Culture TypeSolid mediaLiquid culture with continuous agitation
Light Intensity50-80 μmol m⁻² s⁻¹Adjusted based on expression system
Media SupplementsBCDATBCDAT with additional nitrogen source
Harvest Timing7 daysDetermined by expression kinetics analysis
  • Post-Translational Modifications: Consider the incorporation of cofactors necessary for Cytochrome b6 function. Ensure sufficient iron availability in the culture medium for proper heme incorporation.

  • Stabilization Strategies: Co-express chaperones that assist in proper folding of Cytochrome b6 or partner proteins that stabilize the cytochrome b6f complex structure .

  • Extraction Protocols: Use gentle extraction methods that preserve protein structure and function, such as low-temperature mechanical disruption in the presence of appropriate detergents and protease inhibitors.

By systematically optimizing these parameters, researchers can achieve higher yields of functional recombinant Cytochrome b6 for downstream applications and analyses .

What control experiments are essential when studying electron transport chain components in Physcomitrella patens?

  • Wild-Type Controls: Always include wild-type P. patens grown under identical conditions as the experimental samples. This provides the baseline for all comparative analyses.

  • Known Inhibitor Treatments: Use specific electron transport inhibitors as positive controls:

    • DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) to block electron transfer from PSII to plastoquinone

    • DNP-INT (2-iodo-6-isopropyl-3-methyl-2',4,4'-trinitrodiphenyl ether) to specifically inhibit the cytochrome b6f complex

    • Antimycin A to inhibit electron transfer at the cytochrome bf complex

  • Complementation Controls: For knockout or modified petB lines, include complemented lines where the wild-type gene is reintroduced to confirm phenotype rescue.

  • Environmental Variation Controls: Test phenotypes under multiple environmental conditions (light intensities, temperature regimes) to distinguish constitutive from condition-dependent effects.

  • Transcript Level Controls: Measure transcript levels of petB and related genes using RT-qPCR to distinguish between transcriptional and post-transcriptional effects.

  • Protein Level Controls: Perform immunoblot analysis using antibodies against Cytochrome b6 and other complex components to verify protein expression and stability.

  • Specificity Controls: Include mutants affecting other components of the electron transport chain to demonstrate the specificity of petB-related phenotypes.

  • Technical Controls: For spectroscopic measurements, include instrument calibration standards and biological replicates from independent transformation events to account for position effects and transformation-related variations .

How can researchers integrate multi-omics data to understand the system-wide impact of petB modifications?

Integrating multi-omics data provides a comprehensive understanding of how petB modifications affect the entire photosynthetic apparatus and cellular metabolism in Physcomitrella patens. A methodological framework for this integration includes:

  • Data Collection Strategy:

    • Transcriptomics (RNA-seq): Capture gene expression changes in nuclear and chloroplast genomes

    • Proteomics: Quantify protein abundance changes, particularly in thylakoid membrane complexes

    • Metabolomics: Measure changes in photosynthetic intermediates and downstream metabolites

    • Phenomics: Assess growth rates, photosynthetic efficiency, and stress responses

  • Integration Techniques:

    • Correlation Networks: Construct networks linking transcripts, proteins, and metabolites that show coordinated responses

    • Pathway Enrichment Analysis: Identify biological processes and metabolic pathways significantly affected by petB modification

    • Causal Inference Models: Use time-series data to infer cause-effect relationships between molecular changes

    • Machine Learning Approaches: Implement supervised learning algorithms to identify patterns in multi-omics data predictive of phenotypic outcomes

  • Visualization Strategies:

    • Multi-layer Network Diagrams: Visualize interconnections between different molecular levels

    • Heat Maps with Hierarchical Clustering: Identify co-regulated modules across omics layers

    • Principal Component Analysis: Reduce dimensionality and identify major sources of variation

  • Validation Approaches:

    • Targeted Gene Modifications: Test predictions by creating additional mutants in genes identified through multi-omics analysis

    • Flux Analysis: Measure carbon and electron flow through affected pathways

    • Pharmacological Interventions: Use specific inhibitors to verify predicted pathway connections

This integrative approach allows researchers to move beyond simple cause-effect relationships and understand the complex adaptive responses that maintain cellular homeostasis following petB modifications, providing insights into the robustness and plasticity of the photosynthetic apparatus .

What are the emerging applications of recombinant Physcomitrella patens systems for studying electron transport chain components?

Recombinant Physcomitrella patens systems are opening new frontiers in the study of electron transport chain components, with several cutting-edge applications:

  • Synthetic Biology Approaches: Engineering novel electron transport pathways by introducing modified versions of Cytochrome b6 with altered redox properties or substrate specificities. This allows the exploration of fundamental electron transfer principles and the development of modified photosynthetic systems with enhanced efficiency.

  • Optogenetic Control: Integration of light-sensitive domains with Cytochrome b6 or its regulatory elements enables precise temporal control of electron transport. This approach permits the study of electron flow dynamics in intact plants with unprecedented temporal resolution.

  • Single-Molecule Studies: Expression of tagged versions of Cytochrome b6 compatible with advanced microscopy techniques allows visualization of protein dynamics and interactions within the thylakoid membrane. These studies reveal the spatial organization and mobility of electron transport complexes in vivo.

  • Directed Evolution: Application of directed evolution approaches to Cytochrome b6 in P. patens to select for variants with enhanced stability, activity, or novel functions. This approach harnesses the natural variation-selection paradigm to explore the functional landscape of this essential protein.

  • Bioelectronic Interfaces: Development of moss-based biophotoelectrochemical cells where engineered P. patens with modified electron transport chains generate photocurrents for biosensing applications or renewable energy production.

  • Stress Response Models: Utilization of recombinant P. patens expressing modified Cytochrome b6 variants to study how alterations in electron transport affect plant responses to environmental stresses like high light, temperature fluctuations, and drought.

These emerging applications leverage the genetic tractability of P. patens and its efficient homologous recombination to provide insights into fundamental aspects of photosynthesis while also exploring potential biotechnological applications .

How can structural biology approaches enhance our understanding of recombinant Cytochrome b6 in Physcomitrella patens?

Structural biology approaches provide crucial insights into the function and interactions of recombinant Cytochrome b6 in Physcomitrella patens, with several methodological considerations:

  • Cryo-Electron Microscopy (Cryo-EM): This technique allows visualization of the entire cytochrome b6f complex at near-atomic resolution without the need for crystallization. Sample preparation involves:

    • Isolation of thylakoid membranes from P. patens

    • Detergent solubilization optimized to maintain complex integrity

    • Gradient purification to isolate intact complexes

    • Vitrification on EM grids for imaging

  • X-ray Crystallography: While challenging, crystallization of recombinant Cytochrome b6 or the entire b6f complex provides detailed structural information:

    • Expression of His-tagged variants for affinity purification

    • Screening multiple detergents and crystallization conditions

    • Co-crystallization with inhibitors or substrate analogs to capture different conformational states

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For studying specific domains or interactions:

    • Isotopic labeling (¹⁵N, ¹³C) of recombinant protein expressed in P. patens

    • Analysis of protein dynamics and conformational changes

    • Mapping of interaction surfaces with partner proteins or small molecules

  • Molecular Dynamics Simulations: Complement experimental structures with computational approaches:

    • Simulate membrane embedding and lipid interactions

    • Model electron transfer pathways through the complex

    • Predict effects of mutations on protein stability and function

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides insights into protein dynamics and solvent accessibility:

    • Maps regions of flexibility and rigidity within Cytochrome b6

    • Identifies conformational changes upon binding of partners or substrates

    • Requires minimal sample amounts compared to other structural techniques

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.