Recombinant Physcomitrella patens subsp. patens NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Chloroplast NDH Complex

The ndhA subunit is integral to the chloroplast NDH complex, which facilitates cyclic electron flow (CEF) around Photosystem I (PSI) and chlororespiration . Key functions include:

  • Electron Transfer: Mediates electron transfer from NAD(P)H to plastoquinone, balancing ATP/NADPH ratios under stress .

  • Stress Adaptation: Essential for acclimation to high light, drought, and oxidative stress by stabilizing PSI .

  • Genome Stability: Requires splicing by P-subfamily pentatricopeptide repeat (PPR) proteins (e.g., PpPPR_66) for transcript maturation .

Knockout mutants of ndhA in P. patens exhibit abolished NDH activity, leading to impaired PSI cyclic electron transport and increased photodamage .

Functional Studies

  • Gene Targeting: P. patens’ high homologous recombination efficiency enables precise ndhA knockout/knock-in studies .

  • Protein-Protein Interactions: Recombinant ndhA is used to map binding partners in the NDH complex via immunoprecipitation and yeast two-hybrid assays .

Biotechnological Applications

  • Molecular Farming: P. patens is engineered for scalable recombinant protein production, including therapeutic proteins, leveraging its post-translational modification capabilities .

  • Stress-Tolerant Crops: Insights from ndhA function inform strategies to enhance photosynthetic efficiency in crops under abiotic stress .

Comparative Analysis of Wild-Type and ndhA Knockout Phenotypes

ParameterWild-TypendhA Knockout
NDH ActivityFunctional cyclic electron flow Absent
Stress ToleranceHigh resilience to light/drought Increased photodamage
Chloroplast StructureIntact thylakoid membranes Disrupted NDH complex assembly

Future Directions

Current research focuses on:

  • Resolving the cryo-EM structure of the NDH complex to elucidate ndhA’s role in quinone binding .

  • Engineering ndhA variants to enhance CEF efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-368
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
ndhA
Target Protein Sequence
MGFNTNLKEQVITFFSALSLSKDFFNFIWIAFSILILLLTITIGVLVLVWLERKISAGIQ QRIGPEYAGPLGIIQALADGFKLLLKEDIIPSKGDNWLFNIGPAIVVIPVFLSYLVIPFG HNIILADLNIGVFFWIAISSIVPLGLLMAGYGSNNKYSFLGGLRAAAQSISYEIPLALCV LSISLQLSNSLSTVDIVEAQAKYGFWGWNVWRQPIGFLAFFIASLAECERLPFDLPEAEE ELVAGYQTEYSGIKFGLFYVASYLNLLASSLFVTILYLGGWHFSIPFLLNSNYLEWVFSH GSNQVINIIIGIIIVLIKSYLFSFIAIMTRWTLPRVRMDQLLDLGWKFLLPIALGNLLLT ASFQAFLL
Uniprot No.

Target Background

Function
NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. It couples the redox reaction with proton translocation, conserving redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of ndhA in Physcomitrella patens?

The NDH complex contributes to photoprotection mechanisms by preventing over-reduction of the electron transport chain, particularly under stress conditions. Research indicates that disruption of ndhA leads to a complete loss of the chloroplast NDH complex, demonstrating its essential structural role in the assembly or stability of this multiprotein complex . Unlike in some vascular plants where NDH function can be partially compensated by alternative pathways, in P. patens the loss of NDH activity through ndhA disruption results in clear photosynthetic phenotypes that can be measured through chlorophyll fluorescence analysis.

How does the structure of ndhA relate to its function in the NDH complex?

The ndhA gene encodes a protein that forms an integral part of the membrane-embedded arm of the NDH complex. As a structural component, ndhA contains multiple transmembrane domains that anchor it within the thylakoid membrane. The proper folding and integration of this protein are essential for the assembly of a functional NDH complex.

The ndhA transcript in P. patens contains an intron that requires proper splicing for functional protein production. Studies have demonstrated that specialized RNA-binding proteins, particularly pentatricopeptide repeat (PPR) proteins, are required for this splicing event . When splicing is impaired, as observed in PpPPR_66 knockout mutants, the NDH complex fails to assemble properly despite the presence of other ndh transcripts . This indicates that the processing of ndhA is a rate-limiting step in NDH complex formation in P. patens chloroplasts.

What are the optimal growth conditions for P. patens in ndhA research?

For reliable and reproducible research involving ndhA in P. patens, standardized growth conditions are essential. P. patens should be cultivated on heat-sterilized agar BCD medium at approximately 27.5°C with exposure to fluorescent light in an alternating 12-hour light and 12-hour dark cycle . This photoperiod ensures normal photosynthetic function and development of the gametophyte.

The BCD medium composition should include:

  • 10 mL B stock solution (25 g MgSO₄·7H₂O per 1 L H₂O)

  • 10 mL C stock solution (25 g KH₂PO₄ per 1 L H₂O, adjusted to pH 6.5)

  • 10 mL D stock solution (1.01 g KNO₃, 1.25 g FeSO₄·7H₂O per 1 L H₂O)

  • 920 mg di-ammonium (+) tartrate

  • 4 g Agargel

After autoclaving at 121°C at 15 psi for 25 minutes, 1 mL of 1 M CaCl₂ should be added. For propagation, mature P. patens samples can be cut into 5mm pieces and placed onto fresh BCD plates, with six colonies typically grown per plate . These standardized conditions ensure optimal growth for molecular and biochemical studies of ndhA function.

What methodologies are most effective for analyzing ndhA transcript splicing?

The analysis of ndhA transcript splicing requires a combination of molecular techniques that can distinguish between spliced and unspliced forms. Reverse transcription PCR (RT-PCR) using primers flanking the intron region has proven effective for detecting splicing defects in ndhA transcripts . This approach allows researchers to visualize both the correctly spliced form and any aberrant or unspliced variants.

For more quantitative analysis, quantitative RT-PCR (qRT-PCR) can be employed to measure the relative abundance of spliced versus unspliced transcripts. Northern blot analysis provides additional information about transcript size and processing patterns. When studying the factors that influence ndhA splicing, RNA immunoprecipitation (RIP) assays can identify proteins that directly interact with the ndhA transcript during the splicing process.

RNA-seq analysis offers a comprehensive view of transcriptome-wide changes that may occur in response to ndhA splicing defects, revealing potential downstream effects or compensatory mechanisms. When combined with polysome profiling, researchers can determine whether unspliced ndhA transcripts are recruited to ribosomes, providing insights into translational regulation.

How can researchers generate and verify knockout mutants of genes affecting ndhA function?

P. patens offers exceptional advantages for targeted gene manipulation due to its high rate of homologous recombination, making it an ideal system for studying ndhA function through knockout approaches . For generating knockout mutants of genes that affect ndhA function, such as splicing factors, the following methodological approach is recommended:

  • Design targeting constructs with homology arms flanking the gene of interest, typically 500-1000 bp in length.

  • Transform P. patens protoplasts with the construct using PEG-mediated transformation.

  • Select transformants on medium containing appropriate antibiotics.

  • Verify integration at the correct locus using PCR with primers that span the integration site.

  • Confirm the absence of the target gene transcript using RT-PCR .

How do contradictions in ndhA research findings across different species reconcile?

Contradictions in ndhA research findings across different plant species often stem from evolutionary divergence in NDH complex function and regulation. When analyzing contradictory results, researchers should consider:

  • Phylogenetic context: The evolutionary position of P. patens as a bryophyte versus angiosperms may explain functional differences in NDH components.

  • Experimental conditions: Variations in growth conditions, light intensity, and stress treatments can significantly influence NDH activity and the phenotypic consequences of ndhA disruption.

  • Methodological differences: Techniques for measuring NDH activity vary across studies, from chlorophyll fluorescence analysis to biochemical assays and proteomics approaches.

  • Genetic compensation: Different plant lineages may have evolved distinct compensatory mechanisms for NDH dysfunction .

A systematic approach to reconciling contradictory findings includes standardizing experimental conditions, employing multiple independent techniques to measure the same parameters, and performing comparative studies across species under identical conditions. When contradictions persist, they often point to genuine biological differences that provide insights into the evolution of photosynthetic mechanisms .

What is the relationship between ndhA function and stress response in P. patens?

The NDH complex, of which ndhA is an essential component, plays a significant role in plant responses to various stress conditions. In P. patens, the relationship between ndhA function and stress response can be examined through several experimental approaches:

  • Exposure to abiotic stressors such as high light, drought, or temperature extremes, followed by assessment of ndhA expression and splicing patterns.

  • Analysis of reactive oxygen species (ROS) accumulation in wild-type versus ndhA-deficient plants under stress conditions, given that P. patens activates defense mechanisms similar to flowering plants, including ROS accumulation .

  • Evaluation of stress-responsive gene expression patterns in ndhA mutants compared to wild-type plants.

  • Assessment of photosynthetic parameters under fluctuating light conditions, which specifically challenge NDH function.

Research indicates that P. patens, like flowering plants, activates multiple defense mechanisms in response to stress, including programmed cell death, cell wall fortification, and induction of defense-related genes . The relationship between these responses and ndhA function represents an important area for investigation, particularly given the role of the NDH complex in photoprotection.

What protocols are recommended for recombinant ndhA protein production?

Production of recombinant ndhA protein requires specialized approaches due to its integral membrane protein nature. The following protocol represents a consensus approach:

  • Gene synthesis or amplification: The ndhA coding sequence should be optimized for the expression system, with coding sequence corresponding to the mature protein (post-splicing) .

  • Expression vector selection: Vectors with strong, inducible promoters and appropriate tags for purification (His-tag or other affinity tags) are recommended .

  • Expression conditions: The tag type may be determined during the production process based on protein solubility and expression levels .

  • Storage: The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided .

For functional studies, it is essential to verify that the recombinant protein retains its native conformation and activity. This can be assessed through structural analyses such as circular dichroism and functional assays that measure electron transport activity when the protein is reconstituted with other NDH complex components.

How can researchers effectively assess NDH complex integrity and function?

Assessment of NDH complex integrity and function in P. patens requires multiple complementary approaches:

  • Immunoblot analysis using antibodies against various NDH subunits can determine whether disruption of ndhA affects the accumulation of other components of the complex .

  • Blue-native PAGE followed by immunoblotting can reveal the presence or absence of intact NDH complexes and subcomplexes.

  • Chlorophyll fluorescence analysis provides a non-invasive method for assessing NDH activity in vivo. The post-illumination rise in chlorophyll fluorescence is particularly indicative of NDH-mediated cyclic electron flow.

  • Electron transport measurements using artificial electron acceptors can quantify NDH activity in isolated thylakoid membranes.

  • Proteomic analysis of thylakoid membrane complexes can provide comprehensive information about NDH complex composition and abundance.

In knockout studies, these techniques have revealed that disruption of proper ndhA transcript splicing leads to a complete loss of the chloroplast NDH complex, demonstrating the essential role of ndhA in complex assembly or stability .

What approaches are recommended for studying ndhA transcript regulation?

To investigate the regulation of ndhA transcript processing and expression in P. patens, researchers should consider the following approaches:

  • Transcript analysis under different environmental conditions: Examine how light intensity, temperature, and stress conditions affect ndhA transcript levels and splicing efficiency using RT-PCR or qRT-PCR .

  • Identification of trans-acting factors: RNA-binding proteins that interact with ndhA transcripts can be identified using RNA electrophoretic mobility shift assays (EMSA) or RNA immunoprecipitation followed by mass spectrometry.

  • Characterization of cis-regulatory elements: Mutation analysis of potential regulatory sequences within the ndhA gene can identify elements critical for proper expression and splicing.

  • Analysis of splicing intermediates: Lariat RT-PCR can detect and quantify splicing intermediates, providing insights into the efficiency and mechanism of ndhA intron removal.

  • Developmental regulation: Examination of ndhA expression patterns across different developmental stages of P. patens, from protonema to gametophores, can reveal tissue-specific regulation .

Research has demonstrated that P-subfamily pentatricopeptide repeat proteins, specifically PpPPR_66, are required for proper splicing of the ndhA transcript in P. patens . This highlights the importance of RNA-binding proteins in post-transcriptional regulation of chloroplast genes.

Comparative Analysis of Wild-Type and ndhA-Affected Phenotypes

ParameterWild-Type P. patensPlants with ndhA Splicing DefectsSignificance
Growth morphologyNormal gametophyte developmentWild-type-like growth phenotypendhA function is not essential for basic growth
Chlorophyll fluorescenceNormal post-illumination riseAberrant chlorophyll fluorescenceIndicates defects in NDH activity
NDH complex integrityComplete complex formationComplete loss of NDH complexndhA is essential for complex stability
Transcript processing of other ndh genesNormal splicing and accumulationNormal processing patternsndhA splicing defect is specific
Stress toleranceNormal response to abiotic stressPotentially compromised (requires further research)NDH function may contribute to stress resistance

This comparative analysis demonstrates that while ndhA function is dispensable for basic growth and development under standard laboratory conditions, it is essential for NDH complex formation and activity in P. patens. The specific impairment of ndhA transcript splicing, while other ndh transcripts remain properly processed, highlights the unique regulatory mechanisms governing this particular gene .

Methodological Considerations for P. patens Growth in ndhA Research

Growth ParameterRecommended ConditionAlternative ConditionsEffect on Research
Temperature27.5°C22-25°CLower temperatures may alter splicing efficiency
Light cycle12h light/12h dark16h light/8h darkExtended photoperiod may increase NDH demand
Medium compositionBCD medium with specified components Alternative media (e.g., BCDAT)May affect growth rate and development
Propagation method5mm tissue fragments Protoplast regenerationDifferent developmental stages may show varied ndhA expression
Treatment durationVariable depending on experimentShort (20 min) or long (1.5 hr) exposures Duration affects cellular response magnitude

Maintaining consistent growth conditions is crucial for reproducible research on ndhA function. The conditions described in the table represent established protocols that facilitate reliable assessment of NDH complex activity and ndhA transcript processing . Researchers should carefully document any deviations from these standard conditions when reporting experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.