Recombinant Physcomitrella patens subsp. patens NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
ndhC
Target Protein Sequence
MFLLPKYNSFFIFLLLASVIPILAFSISKFLAPNNTQGPEKLTSYESGIEPMGDAWIQFQ IRYYMFALVFVIFDVETVFLYPWAMSFNDLGLSAFIEALVFVFILIIGLVYAWRKGALEW S
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation, conserving energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Physcomitrella patens and why is it important as a model system for studying chloroplastic proteins?

Physcomitrella patens is a non-vascular moss that has been used as an experimental organism for more than 80 years. Within the past two decades, its use as a model to explore plant functions has increased dramatically due to several advantageous characteristics . As a model system, P. patens offers unique benefits for studying chloroplastic proteins like ndhC because it:

  • Spends the majority of its life cycle in the haploid state, allowing direct forward genetic analysis and application of experimental techniques similar to those used in microbes and yeast

  • Features highly efficient homologous recombination, making it an exceptional tool for studying gene function and recombinant protein production

  • Has a relatively simple development pattern, generating only a few tissues containing a limited number of cell types

  • Possesses a fully sequenced and assembled genome with physical and genetic maps and over 250,000 expressed sequence tags

  • Can be easily cultured under laboratory conditions with established protocols for maintenance and propagation

These characteristics make P. patens particularly valuable for investigating chloroplastic proteins involved in photosynthesis and energy metabolism.

What is the general function of NAD(P)H-quinone oxidoreductase complexes in photosynthetic organisms?

The NAD(P)H-quinone oxidoreductase complex (NDH-1) in photosynthetic organisms like cyanobacteria and plants plays multiple crucial roles in cellular energetics. This complex is related to Complex I of eubacteria and mitochondria and serves three primary functions:

  • Respiratory electron transfer: Contributing to cellular respiration pathways

  • Cyclic electron transfer (CET) around Photosystem I: Enabling additional ATP synthesis without NADPH production

  • Carbon concentration mechanism (CCM): Particularly in cyanobacteria, assisting in concentrating CO₂ around Rubisco

In P. patens, as in other photosynthetic organisms, the ndhC subunit forms part of this complex and contributes to these fundamental bioenergetic processes. The NDH-1 complex exists in different forms (such as NDH-1L, NDH-1MS, and NDH-1MS') that serve specific functions depending on environmental conditions like CO₂ availability .

How does the structure of the NDH complex in Physcomitrella patens compare to that in seed plants?

The NDH complex structure in P. patens represents an evolutionary intermediate between cyanobacterial ancestors and modern seed plants. Research findings indicate that:

  • P. patens possesses both cyanobacteria-like features and land plant adaptations in its NDH complex

  • The complex contains core subunits (including ndhC) that are conserved across photosynthetic organisms, reflecting their fundamental importance in electron transport

  • Some antenna polypeptides associated with the photosynthetic machinery are present only in land organisms, suggesting they play a role in adaptation to the sub-aerial environment

  • The photo-protective mechanisms in P. patens are very similar to those in seed plants, consistent with the detection of orthologs of proteins like PsbS that are involved in non-photochemical quenching

  • Unlike some cyanobacteria, P. patens NDH complexes include land plant-specific subunits that reflect adaptation to terrestrial conditions

What are the established protocols for cultivating Physcomitrella patens for recombinant protein studies?

Successful expression of recombinant ndhC in P. patens requires optimized cultivation conditions. Based on established protocols, researchers should follow these methodological steps:

  • Medium preparation:

    • Use BCD medium supplemented with appropriate nutrients and growth factors

    • For protonemal growth, supplement with diammonium tartrate

  • Inoculation and growth:

    • Harvest tissue with a spatula from 10-day-old plants grown from tissue-clump inocula

    • Blend the tissue in water for approximately 2 minutes to create a pipettable suspension (avoid overblending, which leads to poor regeneration)

    • Pipette 1-2 ml of the protonemal suspension onto each prepared Petri dish and spread evenly

    • Incubate for 7 days at 25°C under a 16-hour light/8-hour dark cycle with white light at intensities between 5-20 Wm⁻²

  • Long-term storage and maintenance:

    • Cultures can be maintained as individual spot-inoculums with up to 32 independent isolates on a 9-cm Petri dish

    • For prolonged storage, keep multiple plates in an incubator with 2 hours of light per day at 10°C

These cultivation techniques provide the foundational biological material for subsequent molecular work with ndhC and other chloroplastic proteins.

What genetic manipulation approaches are most effective for studying ndhC function in Physcomitrella patens?

P. patens offers exceptional genetic tractability for studying genes like ndhC through several complementary approaches:

  • Gene targeting via homologous recombination:

    • P. patens is uniquely suited for targeted gene replacement due to its exceptionally efficient homologous recombination

    • This allows precise deletion, modification, or tagging of the ndhC gene at its native locus

    • Targeted knockout mutants can be generated with relatively high efficiency compared to other plant systems

  • RNA interference methods:

    • For conditional knockdowns, RNAi approaches can be employed to study partial loss of ndhC function

    • This is particularly valuable when complete knockout might be lethal

  • Conditional genetic systems:

    • Dexamethasone, heat-shock, and homoserine-lactone-inducible promoter systems have all been successfully used in P. patens

    • These systems allow for temporal control of ndhC expression, enabling the study of essential genes

  • Tagged protein expression:

    • C-terminal fusion of ndhC with his-tagged superfolder Green Fluorescent Protein (GFP) can be used for localization and purification studies

    • This approach has been successful for visualizing NDH complex components via electron microscopy and single particle averaging

  • CRISPR/Cas9 genome editing:

    • While not explicitly mentioned in the search results, modern CRISPR approaches have been adapted for P. patens, offering additional precision in gene modification

What methods are most effective for isolating and characterizing the NDH complex containing ndhC?

Isolation and characterization of the NDH complex containing ndhC requires specialized biochemical approaches:

  • Protein isolation:

    • Blue-native polyacrylamide gel electrophoresis (BN-PAGE) combined with SDS-PAGE provides effective separation of intact NDH complexes

    • The characteristic protein spot pattern visible in the SDS-PAGE dimension can confirm the presence of specific NDH complex types (e.g., NDH-1L)

  • Mass spectrometry:

    • For protein identification and characterization of post-translational modifications

    • Particularly useful for identifying interaction partners of ndhC within the complex

  • Electron microscopy and single particle averaging:

    • Used to determine the location of specific subunits within the NDH complex

    • Has been successfully applied to visualize NDH complex components after C-terminal fusion with GFP tags

  • Functional assays:

    • Measurements of NDH-mediated cyclic electron transport around PSI under varying CO₂ conditions can assess the functional impact of ndhC modifications

    • Low temperature fluorescence spectra can characterize changes in photosystem properties

How does the expression and regulation of ndhC differ under varying environmental conditions?

The expression and activity of NDH complexes in P. patens show significant environmental responsiveness, with important implications for ndhC regulation:

  • CO₂ concentration effects:

    • Under high CO₂ (HC) conditions, NDH-1L (which would contain ndhC) is the dominant complex

    • Under low CO₂ (LC) conditions, NDH-1MS is strongly induced

    • These differential expressions suggest distinct regulatory mechanisms controlling ndhC as part of different NDH complex types

  • Light conditions:

    • NDH complex composition and activity respond to changing light conditions

    • This adaptation is critical for optimizing photosynthetic efficiency while minimizing photooxidative damage

  • Developmental regulation:

    • Expression patterns may vary between the filamentous protonemata and the leafy gametophore stages

    • This developmental regulation reflects the changing energetic needs during the P. patens life cycle

Understanding these regulatory patterns requires integrated transcriptomic, proteomic, and physiological approaches to capture the multifaceted response of ndhC to environmental variables.

What is the evolutionary significance of ndhC conservation between Physcomitrella patens and other photosynthetic organisms?

The evolutionary trajectory of ndhC offers insights into photosynthetic adaptation during land plant evolution:

  • Conservation across lineages:

    • Core subunits of the NDH complex, including ndhC, show significant conservation from cyanobacteria to land plants

    • This conservation underscores their fundamental importance in photosynthetic electron transport

  • Land adaptation signatures:

    • Comparative sequence analysis reveals that while core functions are conserved, specific adaptations in ndhC and associated proteins emerged during the transition to land

    • These adaptations likely addressed challenges posed by the terrestrial environment, including variable light intensity, temperature fluctuations, and water availability

  • Functional specialization:

    • The integration of ndhC into different NDH complex types (NDH-1L vs. NDH-1MS/MS') demonstrates functional specialization for different environmental challenges

    • This specialization represents an evolutionary innovation for coping with the heterogeneous conditions of terrestrial habitats

Comparative genomic approaches, combined with structural biology and biochemical characterization, continue to elucidate how ndhC evolution contributed to land plant adaptation.

What are the current challenges and limitations in expressing and purifying recombinant ndhC?

Despite the advantages of P. patens as an expression system, researchers face several challenges when working with recombinant ndhC:

  • Membrane protein expression:

    • As a transmembrane component of a multi-subunit complex, ndhC presents inherent challenges for expression and purification

    • Maintaining proper folding and assembly is critical for functional studies

  • Complex assembly:

    • ndhC functions as part of larger NDH complexes

    • Expression studies must consider co-expression of interacting partners to achieve proper complex formation

    • Absence of specific subunits can prevent complex assembly, as demonstrated by the absence of NDH-1L in NdhP deletion mutants

  • Functional verification:

    • Simple expression is insufficient; functional incorporation into active NDH complexes must be verified

    • This requires specialized assays for NDH activity and complex integrity

  • Purification challenges:

    • Gentle solubilization conditions must be employed to maintain complex integrity

    • Contamination with other membrane proteins is common during purification

  • Post-translational modifications:

    • Ensuring proper post-translational processing in the recombinant system

    • This may include specific lipid environments required for function

How can recombinant ndhC be utilized to study photosynthetic electron transport mechanisms?

Recombinant ndhC production in P. patens offers several research avenues for understanding photosynthetic electron transport:

  • Structure-function studies:

    • Site-directed mutagenesis of key residues can elucidate their roles in electron transport

    • The ability to generate targeted mutations in P. patens makes it ideal for such studies

  • Interaction mapping:

    • Tagged versions of ndhC can identify interaction partners within the NDH complex

    • This approach can reveal how ndhC contributes to complex assembly and stability

  • Alternative complex formation:

    • Engineering ndhC to incorporate into different NDH complex types

    • This could provide insights into the determinants of complex specificity

  • Cyclic electron flow modulation:

    • Modified versions of ndhC could be used to study how structural changes affect cyclic electron transfer rates

    • This has implications for understanding how plants balance ATP and NADPH production

What role might ndhC play in enhancing photosynthetic efficiency under stress conditions?

The NDH complex plays critical roles in plant stress responses, with ndhC contributing to several protective mechanisms:

  • Photoprotection:

    • NDH-mediated cyclic electron flow contributes to non-photochemical quenching

    • This process dissipates excess excitation energy as heat, protecting the photosynthetic apparatus from damage

    • P. patens activates Non Photochemical Quenching upon illumination, similar to seed plants

  • Redox balance maintenance:

    • By contributing to cyclic electron flow, ndhC helps maintain appropriate redox balance in the chloroplast

    • This is especially important under fluctuating light conditions

  • CO₂ limitation response:

    • Different NDH complex types (containing ndhC) participate in carbon concentration mechanisms

    • This becomes particularly important under CO₂-limited conditions

  • Adaptation to land environment:

    • The evolution of specific features in the NDH complex, including ndhC, represents adaptation to terrestrial conditions

    • These adaptations address challenges such as variable CO₂ availability, higher oxygen levels, water limitations, and enhanced photo-oxidative stress

Future research exploring ndhC modifications could potentially enhance these protective mechanisms, contributing to crop improvement strategies for stress tolerance.

How might comparative studies between cyanobacterial and plant ndhC inform synthetic biology approaches?

Comparative analysis between cyanobacterial and plant ndhC provides valuable insights for synthetic biology applications:

  • Hybrid complex design:

    • Understanding the structural and functional differences between cyanobacterial and plant ndhC could enable the design of hybrid complexes with novel properties

    • These could combine the robust features of both systems for enhanced performance

  • Minimal functional unit identification:

    • Comparative studies can identify the minimal sequence elements required for ndhC function

    • This knowledge facilitates rational design of simplified yet functional electron transport chains

  • Environmental adaptation engineering:

    • Features that enabled ndhC adaptation to land environments could be applied to engineer improved photosynthetic performance in crop plants

    • This has potential applications in developing climate-resilient agricultural varieties

  • Bioenergetic optimization:

    • Understanding how different versions of ndhC contribute to varied NDH complex activities could inform strategies to optimize the ATP:NADPH ratio in photosynthetic organisms

    • This has applications in redirecting photosynthetic energy toward desired metabolic pathways

These comparative approaches leverage the evolutionary innovations captured in different versions of ndhC to inform rational design principles for enhanced or novel photosynthetic capabilities.

What quality control measures are essential when working with recombinant ndhC?

Ensuring the quality and functional integrity of recombinant ndhC requires rigorous quality control measures:

  • Protein verification:

    • Western blotting with specific antibodies to confirm the presence and correct size of ndhC

    • Mass spectrometry to verify protein identity and detect any post-translational modifications

  • Complex assembly verification:

    • Blue-native PAGE to confirm incorporation into the appropriate NDH complex

    • The characteristic protein spot pattern visible in two-dimensional gel electrophoresis can confirm the presence of specific NDH complex types

  • Functional assays:

    • Measurement of NDH-mediated electron transport rates

    • Assessment of cyclic electron flow around PSI under varying CO₂ conditions

  • Structural integrity:

    • Electron microscopy and single particle averaging can verify proper integration into the NDH complex structure

    • This approach has been successfully used to localize subunits within the complex

  • Chloroplast localization:

    • Fluorescence microscopy with tagged versions to confirm proper targeting to the chloroplast and integration into thylakoid membranes

These quality control measures are essential for ensuring that experimental results accurately reflect the native function of ndhC rather than artifacts of the recombinant expression system.

What are the specific challenges in designing mutagenesis studies for ndhC in Physcomitrella patens?

Designing effective mutagenesis studies for ndhC in P. patens requires consideration of several technical challenges:

  • Essential function:

    • If ndhC is essential for photosynthesis and growth, complete knockout may be lethal

    • Conditional mutants or careful design of partial function variants may be necessary, similar to approaches used for other NDH components

  • Complex integration:

    • Mutations that disrupt complex assembly may produce phenotypes that are difficult to distinguish from those affecting the specific function of ndhC

    • Careful design must distinguish between these possibilities

  • Redundancy and compensation:

    • Potential functional redundancy with other electron transport components

    • Unexpected compensatory mechanisms may mask phenotypes

  • Targeting specificity:

    • Ensuring that gene targeting constructs specifically affect ndhC without disrupting neighboring genes

    • This requires careful design of homologous recombination constructs

  • Phenotypic assessment:

    • Developing appropriate assays to detect subtle changes in photosynthetic performance

    • This may include detailed biophysical measurements of electron transport rates and efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.