Recombinant Physcomitrella patens subsp. patens NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Physcomitrella patens NAD(P)H-Quinone Oxidoreductase Subunit 4L (ndhE)

The recombinant Physcomitrella patens subsp. patens NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a full-length protein (1–100 amino acids) expressed in E. coli and fused with an N-terminal His tag for purification and detection . This protein is a component of the chloroplast NADH dehydrogenase (NDH) complex, which plays a critical role in cyclic electron transport (CET) around photosystem I (PSI) and stress adaptation in plants .

Gene Information and Functional Context

The ndhE gene encodes a nuclear-encoded subunit of the NDH complex, which is essential for its stability and activity . Key details include:

AttributeDetails
Gene NamendhE
SynonymsNAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic; NADH-plastoquinone oxidoreductase subunit 4L
Chloroplast RolePart of subcomplex A of the NDH complex, critical for ferredoxin binding and electron transport
Protein LocalizationThylakoid membrane

Functional insights derived from .

Biological Role in the NDH Complex

The NDH complex in Physcomitrella patens is a thylakoid membrane protein supercomplex comprising:

  • 11 chloroplast-encoded subunits (NdhA–K)

  • 24 nuclear-encoded subunits (including ndhE)

Key Functions:

  • Cyclic Electron Transport (CET): Mediates ATP synthesis via PSI without NADPH accumulation, critical for balancing ATP/NADPH ratios under stress .

  • Stress Adaptation: Protects PSI from photoinhibition under fluctuating light or high temperatures by scavenging excess reducing equivalents .

  • Structural Integrity: Subunit ndhE interacts with other subcomplex A proteins (e.g., NDHM, NDHH) to stabilize the NDH complex .

Experimental Evidence:

  • ndhm knockout mutants in P. patens showed reduced NDHH accumulation (>90% decrease) and impaired NDH activity, highlighting interdependence of subunits .

  • The NDH complex’s activity is modulated by ferredoxin (Fd) binding, which facilitates electron donation to the complex .

Research Applications and Experimental Utility

The recombinant ndhE protein is utilized in:

ApplicationMethodology
Protein PurificationAffinity chromatography (His tag)
Western BlottingDetection of endogenous ndhE in P. patens thylakoids using recombinant protein as antigen
Structural StudiesCryo-EM or X-ray crystallography to resolve NDH complex architecture
Functional AssaysIn vitro reconstitution of NDH activity using recombinant subunits

Limitations:

  • The recombinant protein lacks post-translational modifications (e.g., phosphorylation) present in native thylakoid-bound ndhE .

  • Stability issues require aliquoting and storage at -20°C/-80°C to prevent degradation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
ndhE
Target Protein Sequence
MLEHILSLGAYLFCIGIFGLITSRNMVRALMCLELIFNAVNINLITFSNSFDTQQAKGEI FAIFIIAIAAAEAAIGLAIVLAIYRNKNSTRIDQFNLLKW
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. The enzyme couples the redox reaction with proton translocation, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ndhE in Physcomitrella patens chloroplasts?

The ndhE gene encodes a subunit of the chloroplast NADH dehydrogenase-like (NDH) complex in Physcomitrella patens. This complex plays a crucial role in mediating cyclic electron transport around photosystem I (PSI). The NDH complex contributes to the regulation of photosynthetic light reactions, enabling plants to meet metabolic demands in dynamic environmental conditions . Similar to other NDH subunits, ndhE is fundamental for the stability and activity of the whole complex, supporting electron transport particularly during fluctuating light conditions .

Why is Physcomitrella patens a valuable model organism for studying chloroplast genes?

Physcomitrella patens offers several advantages as a model organism for studying chloroplast genes like ndhE. Unlike many other plants, P. patens performs efficient homologous recombination, allowing for precise gene disruptions to study individual gene function . The moss has a relatively simple developmental pattern with two predominant tissue types (protonemal and gametophyte) composed of either filaments or sheets of single cells, facilitating cell lineage analysis and cell biological studies . Additionally, P. patens has a relatively small genome, only three times larger than the Arabidopsis genome, and an extensive expressed sequence tag (EST) database that shows many genes present in higher plants are also found in the P. patens proteome .

How does the NDH complex structure in P. patens differ from that in angiosperms?

The structure of the NDH complex in P. patens differs significantly from that in angiosperms. While angiosperms form a supercomplex with two PSI units through antenna linkers LHCA5 and LHCA6, P. patens NDH likely forms a supercomplex with only one single PSI . This structural difference exists because P. patens genome contains LHCA5 but lacks a LHCA6 homologue, meaning only one PSI antenna should be available to bind NDH . This structural variation may explain the different functional characteristics and evolutionary adaptations of the NDH complex in mosses compared to flowering plants.

What are the most effective methods for generating ndhE knockout mutants in P. patens?

For generating ndhE knockout mutants in P. patens, the most effective approach involves PEG-mediated heat-shock protoplast transformation. The methodology involves:

  • PCR amplification of regions from the target gene (ndhE) from wild-type genomic DNA

  • Cloning these regions upstream and downstream of a selection marker cassette (such as bleomycin resistance)

  • Using the construct for PEG-mediated heat-shock protoplast transformation

  • Selecting stable mutant lines after two rounds of selection on antibiotic-supplemented media

  • Confirming insertions at the expected target locus through PCR analysis of genomic DNA from resistant lines

This approach has been successfully demonstrated with other NDH complex subunits such as NDHM . The protocol should include proper controls and verification of gene disruption through both genomic DNA analysis and transcript level assessment using qRT-PCR .

What are the regulatory considerations when working with recombinant P. patens strains?

When working with recombinant P. patens strains, researchers must adhere to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. These guidelines apply to research with recombinant or synthetically derived nucleic acids, including those that are chemically or otherwise modified analogs of nucleotides . The guidelines define recombinant and synthetic nucleic acid molecules as: (i) molecules constructed by joining nucleic acid molecules that can replicate in a living cell; (ii) nucleic acid molecules that are chemically synthesized or amplified and can base pair with naturally occurring nucleic acid molecules; or (iii) molecules that result from the replication of those described in (i) or (ii) . Institutions receiving NIH funding for any research involving recombinant or synthetic nucleic acids must follow these guidelines unless the research is specifically exempted .

How should growth conditions be optimized for phenotypic analysis of ndhE mutants?

For optimal phenotypic analysis of ndhE mutants in P. patens, growth conditions should be carefully controlled and include both standard and stress conditions to reveal functional aspects of the gene. Based on protocols used for similar NDH complex studies:

  • Standard growth conditions: PpNO3 medium, 24°C, 16h light/8h dark photoperiod at control light intensity of 50 μmol photons m−2s−1

  • Fluctuating light conditions: Design experiments with alternating high and low light intensities (e.g., cycles of 3 minutes at 525 μmol photons m−2s−1 followed by 9 minutes at 25 μmol photons m−2s−1)

  • Comparative analysis: Always include wild-type plants and, when possible, complementation lines and other relevant mutants (e.g., mutations in other NDH subunits or related electron transport components like flavodiiron proteins)

When assessing photosynthetic parameters, measurements should be taken at various time points during development and under different light regimes to capture the phenotypic effects comprehensively.

How can photosynthetic parameters be quantified to assess ndhE function?

To quantitatively assess ndhE function through photosynthetic parameters, researchers should employ multiple complementary approaches:

These parameters should be measured under both steady-state and dynamic light conditions, with particular attention to transitions between different light intensities . The data can be visualized in graphs showing the time course of these parameters during light transitions and fluctuations, as demonstrated in studies of other NDH subunits.

What statistical approaches are recommended for analyzing phenotypic differences in ndhE mutants?

For robust statistical analysis of phenotypic differences in ndhE mutants compared to wild-type plants:

  • Use one-way ANOVA with post-hoc tests (e.g., Tukey's HSD) for comparing multiple genotypes

  • Apply repeated measures ANOVA for time-course experiments, particularly for fluctuating light conditions

  • Include at least three biological replicates and multiple technical replicates for each measurement

  • Calculate standard error or standard deviation and clearly indicate them on graphs

  • Consider non-parametric tests if the data do not meet the assumptions of parametric tests

Statistical significance should be clearly indicated (e.g., p < 0.05, p < 0.01, p < 0.001) and all statistical methods should be thoroughly described in the materials and methods section .

How do you interpret contradictory results between molecular and physiological data?

When facing contradictory results between molecular and physiological data in ndhE studies:

  • First, verify the accuracy of both datasets through technical replicates and alternative methodologies

  • Consider temporal dynamics – molecular changes (transcript or protein levels) often precede physiological effects

  • Examine potential compensatory mechanisms – other genes or pathways may compensate for ndhE dysfunction

  • Investigate environmental influences – some phenotypes may only manifest under specific conditions

  • Consider the sensitivity of different measurement techniques – some may not detect subtle changes

For NDH complex research specifically, contradictions between transcript levels and photosynthetic parameters may occur because the complex forms supercomplexes with other proteins, and disruption of one subunit can have varying effects on the stability and activity of the entire complex . In such cases, biochemical analyses of protein complex formation (using techniques like Blue Native-PAGE) can help resolve contradictions.

How does the function of ndhE in P. patens compare with its role in cyanobacteria and higher plants?

The function of ndhE in the NDH complex shows both conservation and divergence across cyanobacteria, P. patens, and higher plants:

OrganismNDH Complex StructurePrimary FunctionResponse to Fluctuating Light
CyanobacteriaNDH-1 complexCyclic electron flow, CO₂ uptakeCoordinates with FLV for PSI oxidation
P. patensNDH complex with likely one PSICyclic electron flow, prevention of PSI photoinhibitionFunctional redundancy with FLV proteins
Higher plantsNDH complex with two PSI unitsCyclic electron flow, chlororespirationMore significant role in steady-state photosynthesis

What are the molecular mechanisms of interaction between NDH complex and flavodiiron proteins in P. patens?

The molecular mechanisms of interaction between the NDH complex (including ndhE) and flavodiiron proteins (FLVs) in P. patens involve complementary roles in electron transport regulation:

  • Temporal coordination: FLVs primarily function during sudden transitions from low to high light, providing immediate electron transport to prevent PSI over-reduction, while NDH complex activity becomes more significant during prolonged or repeated light fluctuations

  • Spatial coordination: While both systems affect the redox state around PSI, they likely operate through distinct binding sites and electron transport pathways

  • Cumulative effects: The double knockout of both systems (e.g., flva ndhm) shows more severe phenotypes than either single mutant, indicating partially overlapping but distinct functions

  • Regulatory crosstalk: Similar to observations in cyanobacteria, there appears to be dynamic coordination between FLV and NDH-dependent pathways for optimizing PSI oxidation under variable environmental conditions

The molecular details of direct protein-protein interactions between these systems remain to be fully elucidated, but their functional interaction is critical for photoprotection, particularly under fluctuating light conditions that plants frequently encounter in natural environments.

How might CRISPR-Cas9 technology improve gene editing efficiency for studying ndhE function in P. patens?

CRISPR-Cas9 technology offers several advantages for studying ndhE function in P. patens compared to traditional homologous recombination approaches:

  • Increased editing precision: CRISPR-Cas9 allows for more precise gene modifications, including specific point mutations to study the function of individual domains or amino acid residues in the ndhE protein

  • Multiplex gene editing: Simultaneous targeting of multiple genes (e.g., ndhE along with other NDH complex subunits or related electron transport components) to investigate functional redundancies and interactions

  • Inducible gene disruption: Using inducible CRISPR-Cas9 systems to disrupt ndhE function at specific developmental stages or under particular environmental conditions

  • Reduced off-target effects: Newer CRISPR variants with enhanced specificity reduce potential off-target modifications that could confound phenotypic analyses

  • Accelerated experimental timeline: CRISPR-Cas9 approaches can reduce the time required for generating and screening mutant lines compared to traditional methods

When implementing CRISPR-Cas9 for ndhE studies, researchers should consider optimizing guide RNA design for the specific characteristics of the P. patens genome, validating editing efficiency, and thoroughly screening for potential off-target effects.

How can insights from ndhE studies in P. patens inform crop improvement strategies?

Research on ndhE in P. patens provides valuable insights that can inform crop improvement strategies:

  • Photosynthetic efficiency enhancement: Understanding how the NDH complex contributes to electron transport regulation under fluctuating light conditions could guide approaches to improve crop photosynthetic efficiency in field conditions where light intensity constantly changes

  • Stress tolerance engineering: Since NDH complex activity helps prevent photoinhibition under stress conditions, knowledge of its function could inform strategies to enhance crop tolerance to light stress and related abiotic stresses

  • Evolutionary insights for targeted engineering: The differences in NDH complex structure and function between P. patens and higher plants highlight evolutionary adaptations that could be leveraged for crop improvement through targeted engineering of specific subunits or interaction partners

  • Compensatory mechanism identification: Understanding the functional redundancy between NDH and other electron transport systems (like FLVs) could reveal multiple engineering targets to enhance crop photosynthetic resilience

While direct transfer of findings from mosses to crops requires careful consideration of evolutionary differences, the fundamental principles of electron transport regulation revealed through ndhE studies have broad applicability across plant species.

What emerging technologies will advance our understanding of ndhE function at the molecular level?

Several emerging technologies promise to advance our understanding of ndhE function at the molecular level:

  • Cryo-electron microscopy: High-resolution structural analysis of the NDH complex containing ndhE will reveal precise subunit interactions and conformational changes during electron transport

  • Single-molecule tracking: Visualizing the dynamics of NDH complex assembly and movement within the thylakoid membrane in real-time

  • Optogenetic tools: Light-activated control of NDH complex function to study its real-time impact on electron transport and photosynthetic efficiency

  • Synthetic biology approaches: Designing minimal or modified NDH complexes to determine the essential functional elements of ndhE and other subunits

  • Advanced proteomics: Quantitative analysis of protein-protein interactions and post-translational modifications affecting ndhE function under various environmental conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.