Recombinant Physcomitrella patens subsp. patens NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast NDH Complex

The NDH complex functions as an NAD(P)H:plastoquinone oxidoreductase, contributing to:

  • Cyclic Electron Flow (CEF): Recirculates electrons from PSI to the plastoquinone pool, balancing ATP/NADPH ratios .

  • Photoprotection: Prevents PSI photoinhibition under fluctuating light conditions .

  • Stress Responses: Stabilizes photosynthesis during abiotic stress (e.g., drought, high light) .

In P. patens, ndhG is part of a monomeric NDH-PSI supercomplex, distinct from angiosperms, which lack LHCA6 homologs for PSI dimer linkage . Structural studies reveal its PQ-binding pocket interfaces with subunits NdhH, NdhA, and NdhL .

Research Findings and Mutational Analysis

Knockout (KO) studies of NDH subunits in P. patens provide critical insights:

  • NDHM KO Mutants: Loss of ndhM destabilizes subcomplex A (containing ndhG), reducing NDH activity by >90% and impairing PSI-NDH supercomplex assembly .

  • Functional Redundancy: P. patens NDH activity is partially compensated by flavodiiron proteins (FLVs), unlike angiosperms .

  • Electron Transport Metrics:

    • NDH contributes <10% to total CEF in moss under steady-state light .

    • Critical under FLV-deficient conditions to prevent PSI damage .

Applications in Biotechnology

  • Model System: P. patens’s efficient homologous recombination enables precise gene editing for recombinant protein production .

  • Therrapeutic Potential: Moss-based systems are explored for scalable, glycoengineered therapeutic proteins, leveraging chloroplast post-translational modifications .

Comparative Analysis with Angiosperm Homologs

FeatureP. patens ndhGAngiosperm ndhG (e.g., Nymphaea alba)
PSI-NDH SupercomplexMonomeric (1 PSI + 1 NDH)Dimeric (2 PSI + 1 NDH via LHCA5/LHCA6)
LHCA6 HomologAbsentPresent
FLV CompensationHighLow/absent
Genomic StabilityHigh (haploid genome facilitates KO)Moderate (diploid complexity)

Future Research Directions

  • Structural Biology: Cryo-EM studies to resolve full-length ndhG dynamics in the NDH-PSI supercomplex .

  • Stress Adaptation: Elucidate ndhG’s role in moss-specific desiccation tolerance mechanisms .

  • Biotechnological Engineering: Optimize P. patens chloroplasts for high-yield recombinant ndhG production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
ndhG
Target Protein Sequence
MNIIELFGPLQEIIFFILEIGVILGSLGVVLLSNIVYSAFFLGLVFFCISLLYFALNADF VAAAQILIYVGAVNVLIVFAVMLINKPESLKIFPVWTVGDKITLAICLTSFFLLVNIILN TSWSNITVITESKGFLESNFTQNVQRIGSLLLTQYLLPFELLSIVLLVALIGAIVIARRE NLIETNKKKVLQIKKSPTTF
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinones within the photosynthetic electron transport chain, potentially also contributing to chloroplast respiration. Utilizing FMN and iron-sulfur (Fe-S) centers, NDH couples this redox reaction to proton translocation, thereby establishing a proton gradient for energy conservation.
Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the structure of recombinant ndhG compare to native ndhG in Physcomitrella patens?

When expressed recombinantly, ndhG must maintain its structural integrity to perform its native functions. Native ndhG is integrated into the NDH complex within the thylakoid membrane of chloroplasts. Research suggests that in P. patens, the NDH complex forms a supercomplex with a single photosystem I unit, unlike in angiosperms where it binds to two PSI units through LHCA5 and LHCA6 antenna linkers . This structural arrangement is significant because P. patens genome contains LHCA5 but lacks an LHCA6 homologue, supporting the hypothesis that only one PSI antenna is available to bind NDH in this moss species .

What techniques are used to generate recombinant ndhG in Physcomitrella patens?

Generation of recombinant ndhG in P. patens typically involves targeted gene replacement (TGR) or targeted insertion (TI) approaches utilizing the moss's exceptionally efficient homologous recombination system. The methodology involves:

  • Design of targeting constructs containing ndhG sequences flanked by homologous regions corresponding to the targeted locus

  • PEG-mediated transformation of P. patens protoplasts, often coupled with heat-shock treatment

  • Selection of transformants using appropriate antibiotic resistance markers

  • Molecular verification of successful integration through PCR and Southern blot analysis

Transformation efficiency increases with DNA quantity up to an optimum of approximately 20 μg per transformation, as demonstrated in studies with similar gene targeting approaches in P. patens . For knockout studies investigating ndhG function, regions from the target gene are typically amplified by PCR from wild-type genomic DNA and cloned upstream and downstream of an antibiotic resistance cassette, creating a construct that replaces the endogenous gene through homologous recombination .

How can researchers optimize homologous recombination efficiency when manipulating ndhG in Physcomitrella patens?

Optimizing homologous recombination efficiency for ndhG manipulation requires careful consideration of several factors:

  • Length of homologous sequences: Longer homologous flanking regions (typically 500-1000 bp) enhance targeting efficiency

  • DNA quantity: Transformation efficiency increases with DNA quantity up to approximately 20 μg per transformation, though the number of integrated transgenes per plant is not significantly influenced by DNA quantity

  • Protoplast density: Maintaining optimal protoplast concentration (typically 1.6 × 10^6 protoplasts/ml) improves transformation outcomes

  • DNA conformation: Linear DNA constructs generally yield higher targeting frequencies than circular plasmids

  • Selection strategy: Sequential selection with appropriate antibiotics enhances isolation of properly targeted transformants

It's important to note that in P. patens, DNA integration occurs predominantly through homologous recombination rather than non-homologous end-joining (NHEJ), making it an ideal system for precise gene manipulation . When targeting ndhG, researchers should be aware that both targeted gene replacement (TGR) and targeted insertion (TI) can occur, with TGR resulting from homologous recombination at both ends of the construct and TI involving homologous recombination at one end accompanied by non-homologous end-joining at the other .

What phenotypic analyses can detect functional impairments in ndhG-deficient Physcomitrella patens mutants?

Detecting functional impairments in ndhG-deficient P. patens requires comprehensive phenotypic analyses focused on photosynthetic parameters:

  • Photosystem I (PSI) and Photosystem II (PSII) activity measurements using pulse amplitude modulation (PAM) fluorometry:

    • Y(I): Effective photochemical quantum yield of PSI

    • Y(NA): Acceptor-side limitation of PSI

    • Y(ND): Donor-side limitation of PSI

    • Y(II): Effective photochemical quantum yield of PSII

    • NPQ: Non-photochemical quenching

  • Electron transport rate measurements:

    • ETRI (electron transport rate at PSI)

    • ETRII (electron transport rate at PSII)

    • The ETRI/ETRII ratio indicates electron flow balance between photosystems

  • Light response experiments:

    • Exposing plants to different light intensities (e.g., 50 μmol photons m^-2s^-1 and 540 μmol photons m^-2s^-1)

    • Measuring recovery kinetics after light-to-dark transitions

  • Fluctuating light experiments:

    • Subjecting plants to reiterated cycles of saturating and limiting light (e.g., 3 minutes at 525 μmol photons m^-2s^-1 followed by 9 minutes at 25 μmol photons m^-2s^-1)

    • Monitoring progressive changes in PSI and PSII parameters

Based on studies with similar NDH complex subunits, ndhG-deficient mutants would likely show higher acceptor-side limitation [Y(NA)] compared to wild-type plants, particularly after light-to-dark transitions, indicating impaired oxidation of stromal acceptors . The phenotype would likely be more pronounced under fluctuating light conditions, with progressive reduction in Y(I) over repeated light-dark cycles, suggesting cumulative photoinhibition .

What are the current challenges in isolating functionally active recombinant ndhG protein?

Isolating functionally active recombinant ndhG presents several challenges that researchers must address:

  • Membrane protein solubilization: As a component of the thylakoid membrane-embedded NDH complex, ndhG requires appropriate detergents for extraction without compromising structural integrity

  • Maintaining protein-protein interactions: ndhG functions as part of a multisubunit complex and potentially forms supercomplexes with PSI, making preservation of these interactions critical during purification

  • Assessing functional activity: Confirming that recombinant ndhG retains native activity requires specialized assays monitoring electron transport from stromal donors to plastoquinone

  • Structural characterization: Determining whether recombinant ndhG properly integrates into the NDH complex requires techniques such as Blue Native/Clear Native PAGE (BN/CN-PAGE) followed by immunoblot analysis with specific antibodies

  • Verification of complex formation: 2D-immunoblot analysis can help determine whether ndhG contributes to formation of NDH-PSI supercomplexes, as observed with other NDH subunits in P. patens

How can researchers design experiments to differentiate between ndhG and other NDH subunit functions?

Differentiating the specific function of ndhG from other NDH subunits requires strategic experimental design:

  • Generation of knockout mutant series:

    • Single ndhG knockout mutants

    • Knockouts of other NDH subunits (e.g., ndhM)

    • Double/multiple knockouts combining ndhG with other subunit deficiencies

    • Complementation lines reintroducing ndhG or other subunits

  • Comparative phenotypic analysis under varied conditions:

    • Standard growth conditions

    • High light stress

    • Fluctuating light regimes

    • Low CO2 concentrations

    • Temperature stress

  • Biochemical analysis of complex assembly:

    • Blue Native/Clear Native PAGE to assess NDH complex formation

    • Immunoprecipitation with ndhG-specific antibodies to identify interaction partners

    • Mass spectrometry to determine subunit composition changes in various mutants

  • Functional redundancy assessment:

    • Creating double mutants lacking both ndhG and components of alternative electron transport pathways, such as flavodiiron proteins (FLVs)

    • Comparing phenotypes under fluctuating light conditions to detect synergistic effects, similar to the approach used for ndhM/flvA double knockouts

Researchers should carefully document photosynthetic parameters across different light conditions and growth stages, as NDH function may become more critical under specific environmental challenges or developmental phases.

What controls and validations are essential when studying recombinant ndhG function?

Essential controls and validations for studying recombinant ndhG function include:

  • Molecular verification:

    • PCR confirmation of transgene integration at targeted locus

    • RT-PCR to verify absence of ndhG transcripts in knockout lines

    • Quantitative PCR to measure expression levels in complementation lines

    • Southern blot analysis to determine copy number and integration pattern

  • Protein expression verification:

    • Western blot analysis using ndhG-specific antibodies

    • Immunolocalization to confirm chloroplastic localization

    • Mass spectrometry to verify protein identity and modifications

  • Physiological controls:

    • Wild-type plants grown under identical conditions

    • Knockout mutants of other NDH subunits for comparison

    • Plants lacking alternative electron transport pathways (e.g., flvA knockout) as reference

    • Reintroduction of ndhG in knockout backgrounds to verify phenotype rescue

  • Environmental standardization:

    • Carefully controlled light intensity, quality, and photoperiod

    • Standardized temperature, humidity, and growth medium composition

    • Identical age and developmental stage of compared plants

  • Technical replicates and statistical validation:

    • Multiple independent transgenic lines (minimum of two lines, as used for ndhM knockout studies)

    • Biological replicates across different batches

    • Appropriate statistical analyses, such as one-way ANOVA, to determine significance of observed differences

How can researchers assess the impact of ndhG mutations on photosynthetic efficiency during environmental stress?

Assessing ndhG mutation impacts on photosynthetic efficiency during environmental stress requires multifaceted approaches:

  • Fluctuating light experiments:

    • Exposure to reiterated cycles of high and low light intensities

    • Monitoring progressive changes in PSI and PSII parameters

    • Measuring recovery kinetics after each cycle

  • Combined stress treatments:

    • Low temperature combined with high light

    • Drought stress with varying light intensities

    • CO2 limitation under different light conditions

  • Long-term adaptation studies:

    • Growth rate and morphology assessment under prolonged stress

    • Pigment composition analysis using high-performance liquid chromatography

    • Chlorophyll fluorescence imaging to detect spatial heterogeneity in photoinhibition

  • Comparative analysis with other electron transport mutants:

    • Direct comparison with other NDH subunit mutants

    • Assessment alongside mutants affecting alternative electron transport pathways

    • Creation and analysis of double mutants to detect synergistic effects

Based on studies with similar NDH components, ndhG-deficient plants would likely show progressive photoinhibition under fluctuating light conditions, with increasing acceptor-side limitation [Y(NA)] and decreasing PSI yield [Y(I)] over repeated light cycles . This effect would be more pronounced in double mutants lacking both ndhG and alternative electron transport components, such as flavodiiron proteins .

How do researchers interpret contradictory results in ndhG functional studies?

Interpreting contradictory results in ndhG functional studies requires systematic investigation of potential sources of variation:

When contradictions arise, researchers should conduct side-by-side comparisons under identical conditions and employ multiple complementary techniques to measure the same parameters. Additionally, creating double or triple mutants affecting different components of related pathways can help resolve apparent contradictions by revealing functional redundancies or compensatory mechanisms.

What statistical approaches are appropriate for analyzing photosynthetic parameters in ndhG studies?

Appropriate statistical approaches for analyzing photosynthetic parameters include:

Researchers typically conduct experiments using at least two independent transgenic lines, with multiple biological replicates per line, and compare results using appropriate statistical tests such as one-way ANOVA, as demonstrated in studies of similar NDH subunits in P. patens .

How can researchers distinguish direct effects of ndhG mutation from indirect metabolic adaptations?

Distinguishing direct effects of ndhG mutation from indirect metabolic adaptations requires:

  • Time-resolved analyses:

    • Immediate responses (seconds to minutes) following light transitions likely represent direct effects

    • Long-term changes (hours to days) may reflect metabolic adaptations

    • Comparison of acute vs. chronic responses to identify adaptation signatures

  • Inducible gene expression systems:

    • Creating conditional ndhG knockdown lines using inducible promoters

    • Monitoring physiological changes immediately following gene repression

    • Comparing acute effects with stable knockout phenotypes

  • Metabolic profiling:

    • Targeted analysis of photosynthetic intermediates and products

    • Untargeted metabolomics to identify unexpected metabolic adjustments

    • Flux analysis using isotope-labeled compounds

  • Transcriptome and proteome analysis:

    • RNA-seq to identify differentially expressed genes in ndhG mutants

    • Proteomics to detect changes in protein abundance and modifications

    • Comparison of transcript and protein levels to identify post-transcriptional regulations

  • Physiological parameter correlation:

    • Multivariate analysis of photosynthetic parameters

    • Correlation analysis between different measurements

    • Principal component analysis to identify main sources of variation

Direct effects of ndhG mutation would typically manifest as immediate changes in electron transport parameters, particularly acceptor-side limitation [Y(NA)] during light-to-dark transitions, while indirect adaptations might include altered expression of alternative electron transport components or changes in antenna complex composition .

How can recombinant ndhG be used to study evolutionary aspects of the NDH complex?

Recombinant ndhG provides valuable tools for evolutionary studies of the NDH complex:

  • Comparative functional analysis across species:

    • Expression of ndhG from different plant lineages in P. patens ndhG knockout background

    • Assessment of functional complementation to identify conserved domains

    • Evaluation of species-specific adaptations in NDH function

  • Phylogenetic studies:

    • Sequence comparison of ndhG across evolutionary lineages

    • Correlation of sequence variations with ecological adaptations

    • Identification of selection pressures on different protein domains

  • Supercomplex formation analysis:

    • Investigation of NDH-PSI supercomplex assembly across species

    • Comparison of P. patens (which forms NDH complex with one PSI) with angiosperms (which form complexes with two PSI units)

    • Identification of critical residues for protein-protein interactions

  • Functional constraints mapping:

    • Systematic mutation of conserved residues to identify functionally critical regions

    • Correlation of natural sequence variations with functional differences

    • Reconstruction of ancestral ndhG sequences to study functional evolution

This approach can help resolve evolutionary questions, such as why P. patens NDH complex appears to form a supercomplex with a single PSI, unlike angiosperms which bind two PSI units through LHCA5 and LHCA6 antenna linkers .

What techniques can resolve the structure-function relationship of ndhG within the NDH complex?

Resolving structure-function relationships of ndhG requires multidisciplinary approaches:

  • Site-directed mutagenesis:

    • Systematic mutation of conserved residues

    • Creation of chimeric proteins with domains from different species

    • Introduction of specific post-translational modification sites

  • Structural analysis techniques:

    • Cryo-electron microscopy of purified NDH complexes

    • X-ray crystallography of recombinant ndhG or subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other NDH subunits

    • Yeast two-hybrid or split-GFP assays to map interaction domains

    • Chemical cross-linking followed by mass spectrometry (XL-MS)

  • In situ localization:

    • Immunogold labeling for electron microscopy

    • Fluorescence resonance energy transfer (FRET) with tagged NDH components

    • Super-resolution microscopy to visualize complex arrangement in thylakoids

  • Functional correlation:

    • Parallel analysis of structure and function in mutant series

    • Correlation of structural alterations with specific photosynthetic parameters

    • Identification of critical domains for supercomplex formation with PSI

These approaches can help determine whether ndhG contributes to the unique supercomplex formation observed in P. patens, where NDH appears to interact with a single PSI unit rather than two as in angiosperms .

How can high-throughput phenotyping enhance our understanding of ndhG function under diverse environmental conditions?

High-throughput phenotyping offers powerful tools for comprehensive characterization of ndhG function:

  • Automated chlorophyll fluorescence imaging systems:

    • Simultaneous monitoring of multiple plants

    • Spatial resolution of photosynthetic parameters across the plant

    • Temporal tracking of responses to environmental fluctuations

  • Spectroscopic techniques:

    • Hyperspectral imaging to detect subtle phenotypic variations

    • Near-infrared reflectance spectroscopy for non-destructive physiological assessment

    • Thermal imaging to monitor energy dissipation patterns

  • Environmental simulation platforms:

    • Programmable light, temperature, and humidity conditions

    • Simulation of natural fluctuating environments

    • Combinatorial stress treatments

  • Growth and development monitoring:

    • Automated morphometric analysis

    • Growth rate assessment under various conditions

    • Developmental timing and progression tracking

  • Data integration approaches:

    • Machine learning algorithms to identify patterns in multivariate datasets

    • Network analysis to reveal parameter correlations

    • Mathematical modeling to predict responses to novel conditions

These approaches would be particularly valuable for studying ndhG function, as NDH complex impact becomes most evident under fluctuating light conditions rather than constant illumination . High-throughput phenotyping could efficiently characterize responses to numerous environmental scenarios, revealing conditions where ndhG function is most critical.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.