Recombinant Physcomitrella patens subsp. patens Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its inclusion in production.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
ycf4
Target Protein Sequence
MNRESDWLWVEPIMGSRRVSNFCWAAILLFGALGFFFVGISSYFGKDLIPFLSSQQILFV PQGVVMCFYGIAGLFLSFYLWCTIFWNVGSGYNKFDKKKKIVSLFRWGFPGENRRICINF FMKDIQGIRMEVQEGIYPRRTLYMKIKGQQDIPLTRIRENLTLGEIEEKAAELARFLRVS IEGL
Uniprot No.

Target Background

Function
Plays a crucial role in the assembly of the photosystem I complex.
Database Links
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its primary function in photosynthesis?

Ycf4 (hypothetical chloroplast open reading frame 4) is a thylakoid membrane protein essential for the assembly and accumulation of photosystem I (PSI) complexes. Research has demonstrated that Ycf4 forms a large complex (>1500 kD) that contains PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . This complex acts as a scaffold for PSI assembly, with pulse-chase protein labeling revealing that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex . The protein appears to be critical in the post-translational stage of PSI synthesis, facilitating proper assembly or stability of the photosystem rather than the synthesis of individual PSI subunits.

What is the genomic organization of the ycf4 gene in chloroplasts?

In tobacco, the ycf4 gene is located in the chloroplast genome between the psaI and ycf10 genes . This genomic organization is important for targeted knockout experiments, as flanking regions provide homology for recombination events. Molecular analysis using primer sets flanking this region confirms successful knockout by the amplification of a 4.0 kb fragment in ΔYCF4 plants compared to a 2.0 kb fragment in wild-type plants . The chloroplast localization of ycf4 makes it amenable to plastid transformation techniques, which in tobacco have proven highly efficient for generating homoplasmic transformants where all copies of the plastid genome contain the desired modification.

What are the best approaches for generating recombinant Ycf4 protein for functional studies?

For recombinant Ycf4 expression, E. coli-based systems have proven effective, as demonstrated in studies with FtsZ proteins from Physcomitrella patens . A methodological approach would include:

  • Gene synthesis or PCR amplification of the ycf4 coding sequence

  • Cloning into an expression vector with an appropriate affinity tag (His-tag or TAP-tag)

  • Expression in E. coli under optimized conditions (temperature, IPTG concentration)

  • Purification via affinity chromatography

  • Verification of protein integrity via SDS-PAGE and Western blotting

For functional studies, tandem affinity purification (TAP) tagging has been particularly useful, allowing the isolation of intact Ycf4-containing complexes as demonstrated in Chlamydomonas studies . This approach enables the identification of interacting partners via mass spectrometry while preserving native protein-protein interactions.

How can researchers effectively generate and validate Ycf4 knockout mutants?

Based on successful strategies for tobacco ycf4 knockouts, the following methodology is recommended:

  • Design a knockout construct where the complete ycf4 sequence is replaced with a selectable marker (e.g., aadA gene for spectinomycin resistance)

  • Include flanking homologous sequences for targeted recombination

  • Introduce the construct via biolistic bombardment or other plastid transformation methods

  • Select transformants on antibiotic-containing media

  • Validate transformants through multiple rounds of selection to ensure homoplasmy

  • Confirm deletion using PCR with primers flanking the target region

  • Verify homoplasmy via Southern blot analysis using appropriate restriction enzymes and probes

For validation, the detection of a single hybridizing fragment of expected size (~4.0 kb in tobacco) confirms homoplasmy of the integration and ycf4 gene deletion . This rigorous validation is critical as heteroplasmic plants (containing both wild-type and transformed plastid genomes) may not exhibit the full phenotypic effects of the knockout.

What techniques are most effective for studying protein-protein interactions involving Ycf4?

Several complementary approaches have proven effective:

  • Co-immunoprecipitation (Co-IP): Using GFP-Trap magnetic particles with GFP-tagged Ycf4 allows for the identification of interacting partners under physiological conditions . This technique has been successfully employed in Physcomitrella, leveraging its efficient homologous recombination for targeted knock-in of tags at endogenous loci.

  • In silico protein-protein interaction prediction: Computational analysis of potential interactions between full-length Ycf4 and its isolated domains with other chloroplast proteins has revealed that the C-terminus (91 aa) of Ycf4 is particularly important for interactions with photosynthetic proteins .

  • Sucrose gradient ultracentrifugation and ion exchange chromatography: These techniques have been used to purify intact Ycf4 complexes from Chlamydomonas, demonstrating the association between Ycf4 and other proteins like COP2 .

  • Electron microscopy: This technique can visualize purified Ycf4-containing particles, which have been measured at approximately 285 × 185 Å in Chlamydomonas .

What is the precise mechanism by which Ycf4 facilitates PSI assembly?

Current evidence suggests that Ycf4 functions as a scaffold protein that facilitates the spatial organization and assembly of PSI components. Pulse-chase protein labeling studies in Chlamydomonas revealed that PSI polypeptides associated with the Ycf4 complex are newly synthesized and partially assembled . This indicates Ycf4 binds to nascent PSI subunits, potentially creating a microenvironment conducive to proper folding and assembly.

The substantial size of the Ycf4-containing complex (>1500 kD) and its electron microscopy-determined dimensions (285 × 185 Å) suggest it may accommodate multiple PSI assembly intermediates simultaneously . The complex appears to organize as large oligomeric structures, potentially providing multiple interaction surfaces for the various PSI subunits.

In-silico protein-protein interaction studies have revealed that the C-terminal region of Ycf4 (91 amino acids) demonstrates stronger interactions with photosystem-I subunits including psaB, psaC, and psaH, as well as light-harvesting complex (LHC) proteins . These findings suggest a model where the C-terminus of Ycf4 serves as the primary interaction interface for recruiting and organizing PSI components during assembly.

How does the loss of Ycf4 affect chloroplast ultrastructure and function?

Transmission electron microscopy (TEM) of ΔYCF4 tobacco mutants has revealed significant ultrastructural abnormalities in chloroplasts:

ParameterWild-type chloroplastsΔYCF4 chloroplasts
ShapeOblongRounded/spherical
SizeLargerSmaller
Thylakoid organizationDensely packedLess organized
Grana stackingDiscrete, orderlyLess discrete, disordered
Membrane structuresIntact thylakoidsVesicular structures present

Beyond PSI assembly, what additional functions might Ycf4 perform?

Transcriptome analysis of tobacco ΔYCF4 plants has revealed unexpected changes in gene expression patterns that suggest roles beyond PSI assembly. While expression of PSI, PSII, and ribosomal genes remained unchanged in knockout plants, expression of rbcL (encoding the large subunit of RuBisCO), LHC (Light-Harvesting Complex), and ATP synthase genes (atpB and atpL) significantly decreased . This suggests Ycf4 may be involved in coordinating the expression of multiple photosynthetic complexes, potentially serving as a regulatory hub that ensures balanced production of different components of the photosynthetic apparatus.

In-silico interaction studies further support this expanded role, showing that Ycf4 (particularly its C-terminus) interacts not only with PSI components but also with the large and small subunits of RuBisCO . This suggests Ycf4 may bridge the light and dark reactions of photosynthesis, potentially coordinating electron transport with carbon fixation.

Why do studies differ on whether Ycf4 is essential for photosynthesis?

A significant controversy in the field revolves around whether Ycf4 is essential for photosynthesis. This discrepancy can be traced to methodological differences in knockout strategies:

  • Partial vs. Complete Knockout: Studies reporting Ycf4 as non-essential typically removed only part of the gene. For example, Krech et al. (2012) deleted only 93 of 184 amino acids from the N-terminus, leaving the C-terminal 91 amino acids intact . In contrast, studies removing the complete Ycf4 sequence found that mutants could not survive photoautotrophically .

  • Domain Functionality: In-silico protein-protein interaction studies have revealed that the C-terminus of Ycf4 (the portion left intact in partial knockouts) has stronger interactions with photosynthetic proteins than the N-terminus . This explains why partial knockouts retaining the C-terminus might retain partial function.

  • Growth Conditions: Some studies may have used different growth conditions or carbon source concentrations that masked the severity of the phenotype. Complete ΔYCF4 tobacco mutants could only grow at high sucrose concentrations (15-30 mg/L) and were unable to survive in peat moss-containing pots without external carbon .

This conflict underscores the importance of considering protein domain functionality when designing knockout experiments and the need for standardized growth and phenotyping conditions when comparing mutant phenotypes across studies.

What approaches might reveal the temporal dynamics of Ycf4-mediated PSI assembly?

Understanding the temporal dynamics of PSI assembly requires methodologies that can capture intermediates in the assembly process. Future research could employ:

  • Time-resolved cryo-electron microscopy: This could visualize the structural changes in the Ycf4 complex during different stages of PSI assembly.

  • Pulse-chase experiments combined with mass spectrometry: Building on previous work , this approach could track the association and dissociation of different PSI components with the Ycf4 complex over time.

  • Single-molecule tracking in vivo: Using photoactivatable fluorescent proteins fused to Ycf4 and PSI components, researchers could track the dynamics of complex formation in living chloroplasts.

  • Inducible expression systems: Controlling the expression of Ycf4 or PSI components would allow researchers to synchronize assembly events and study the process from initiation.

How might synthetic biology approaches enhance our understanding of Ycf4 function?

Synthetic biology offers powerful tools for dissecting protein function:

  • Domain swapping experiments: Creating chimeric proteins with domains from Ycf4 proteins of different species could help identify species-specific functional adaptations.

  • Minimal functional domains: Synthesizing truncated or minimized versions of Ycf4 could identify the essential structural elements required for PSI assembly.

  • Orthogonal assembly systems: Engineering non-native PSI assembly pathways could test the specificity of Ycf4 interactions and potentially create novel photosynthetic architectures.

  • Directed evolution: Creating libraries of Ycf4 variants and selecting for enhanced photosynthetic efficiency could identify optimized versions of the protein with potential applications in improving plant productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.