Recombinant Physcomitrella patens subsp. patens Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The recombinant Physcomitrella patens subsp. patens Photosystem II CP47 chlorophyll apoprotein (psbB) is a full-length, His-tagged protein derived from the moss Physcomitrella patens. It is encoded by the psbB gene (UniProt ID: Q6YXM8 or P56777, depending on database annotations) and functions as a core component of Photosystem II (PSII), a critical complex in oxygenic photosynthesis .

CP47 binds chlorophyll and stabilizes the PSII reaction center, facilitating light-driven electron transport and oxygen evolution . Its structure includes six transmembrane α-helices and hydrophilic loops, enabling interactions with other PSII subunits like CP43 and the oxygen-evolving complex .

Functional Roles in PSII

  1. Electron Transport: Acts as a scaffold for chlorophyll and facilitates electron transfer from the reaction center to the acceptor side .

  2. Photoprotection: Maintains PSII stability under oxidative stress, though this is less pronounced compared to extrinsic subunits like PSBS .

  3. Oxygen Evolution: Indirectly supports the oxygen-evolving complex (OEC) by stabilizing the PSII core structure .

ELISA and Antibody Development

Recombinant psbB is used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect PSII core proteins in plant extracts. Antibodies specific to psbB (e.g., ATCG00680) enable immunoblotting and immunolocalization studies in Physcomitrella and other plants .

ApplicationMethodOutcome
ELISARecombinant psbB as antigenQuantification of CP47 levels in moss thylakoid membranes
Antibody ProductionImmunization with recombinant psbBGeneration of polyclonal antibodies for PSII subunit detection

Studies on PSII Assembly and Mutagenesis

  • CP47 Knockout Models: Deletion of psbB in Physcomitrella disrupts PSII core assembly, demonstrating its essential role in photosynthetic viability .

  • Interaction with LHCII: In vivo studies suggest CP47 may physically associate with light-harvesting complexes (LHCII) under stress conditions, though direct evidence remains limited .

Advantages of Physcomitrella patens as a Production Host

The moss Physcomitrella patens is favored for recombinant protein production due to:

  • Efficient Homologous Recombination: Facilitates precise gene editing for glycoengineering or knockout studies .

  • Cell Suspension Cultures: Enables scalable production of proteins like psbB .

  • Low Immunogenicity: Ideal for therapeutic protein development, though psbB itself is not therapeutic .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-512
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGITKSWGGWSITGETVNNAGIWSYEGVAAVHIVLSGLLFLAAIWHWVYWDL ELFRDERTGKPSLDLPKIFGIHLFLSGVLCFAFGAFHVTGLFGPGIWVSDPYGLTGKVQP VVPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNVETVLSS SIAAVFFAAFVVAGTMWYGSAATPVELFGPTRYQWDQGFFQQEIDRRIRASKSENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHAVFKDREGHELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSFSDPATVKKY ARRAQLGEIFEFDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQIITRLI
Uniprot No.

Target Background

Function
CP47 is a component of the core complex of photosystem II (PSII). It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP formation.
Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Physcomitrella patens psbB and what role does it play in photosynthesis?

Physcomitrella patens psbB encodes the Photosystem II CP47 chlorophyll apoprotein, a critical component of the photosynthetic apparatus. This protein functions as part of the core antenna complex in Photosystem II (PSII), binding chlorophyll molecules that harvest light energy and transfer it to the reaction center. The CP47 protein contributes to the structural stability of PSII and plays a crucial role in maintaining the efficiency of light harvesting and electron transport.

The protein contains multiple transmembrane domains with numerous chlorophyll binding sites, similar to its homologs in other photosynthetic organisms. In P. patens, the psbB gene is nuclear-encoded but the protein is chloroplast-localized, requiring coordinated expression and translocation mechanisms to ensure proper assembly of functional PSII complexes.

Why is Physcomitrella patens a valuable model organism for photosystem research?

Physcomitrella patens has emerged as an exceptional model organism for photosynthesis research for several compelling reasons. First, it possesses an extraordinarily high frequency of homologous recombination, which facilitates precise genetic manipulation . This feature allows researchers to introduce targeted modifications to the genome with remarkable efficiency.

Second, P. patens has a predominantly haploid gametophyte life cycle, simplifying genetic analysis since recessive mutations are immediately expressed without being masked by dominant alleles . This characteristic, combined with its ability to integrate transformed DNA into its genome through homologous recombination, makes it particularly valuable for studying gene function.

Third, recent advances have overcome a previous limitation – researchers have successfully isolated P. patens strains capable of photoheterotrophic growth (in the presence of sucrose and DCMU, a PSII inhibitor) . This breakthrough allows for the maintenance of photosynthesis mutants that would otherwise be lethal, expanding the scope of possible experimental approaches.

Finally, its position as an early land plant in the green plant lineage provides evolutionary insights into the development of photosynthetic mechanisms during the transition from aquatic to terrestrial environments.

How do techniques for studying psbB in P. patens differ from those used in other model organisms?

Studying psbB in Physcomitrella patens employs several distinctive techniques that capitalize on this organism's unique advantages:

  • Gene targeting approaches: Unlike most plants where random integration of transgenes is common, P. patens allows for precise gene targeting via homologous recombination with efficiencies of 54-60% . This enables precise modifications to the psbB gene, including knockouts, substitutions, and knock-ins.

  • Protoplast transformation: P. patens allows for efficient transformation of protoplasts, which can then be regenerated into complete plants. This technique is particularly valuable for psbB studies and involves:

    • Isolation of protoplasts from protonema tissue

    • Introduction of DNA via PEG-mediated transformation

    • Regeneration of transformants on selective media

    • Confirmation of transformation by PCR and phenotypic analysis

  • CRISPR-Cas9 editing with donor DNA templates: The high efficiency of homology-directed repair (HDR) in P. patens (60% compared to non-homologous end joining) allows for precise editing using CRISPR-Cas9 with donor templates . Various donor formats can be used, including single-strand DNA, double-strand DNA oligos, linearized plasmids, or circular plasmids .

  • Chlorophyll fluorescence analysis: Specialized techniques for measuring chlorophyll fluorescence in P. patens allow researchers to assess PSII function in vivo, providing insights into the functional consequences of psbB modifications .

These methodological differences make P. patens an exceptionally powerful system for studying psbB structure and function compared to traditional plant models.

What expression systems are optimal for producing recombinant P. patens psbB protein?

Several expression systems have been developed for the production of recombinant photosystem proteins like P. patens psbB, each with specific advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)Purification Method
E. coliRapid growth, high expression levels, well-established protocolsLacks post-translational modifications, membrane proteins often form inclusion bodies1-5His-tag affinity chromatography
Homologous P. patensNative post-translational modifications, proper protein foldingSlower growth, lower yields0.5-2His-tag or specialized purification
Cell-free systemsAvoids toxicity issues, rapid productionExpensive, limited scale0.1-1Direct purification from reaction mixture

For P. patens psbB, E. coli expression systems using specialized vectors designed for membrane proteins have shown success, similar to those used for other photosystem components . The protein can be expressed with an N-terminal or C-terminal His-tag to facilitate purification, though careful optimization of expression conditions is necessary to prevent inclusion body formation.

Successful expression typically involves:

  • Codon optimization for the host organism

  • Use of specialized E. coli strains (e.g., C41(DE3) or C43(DE3)) designed for membrane protein expression

  • Induction at lower temperatures (16-20°C) to promote proper folding

  • Addition of specific detergents during purification to maintain protein stability

For functional studies, homologous expression in P. patens itself may be preferable despite lower yields, as it ensures proper assembly with other photosystem components.

How can CRISPR-Cas9 technology be optimized for psbB modifications in P. patens?

CRISPR-Cas9 technology can be highly optimized for psbB modifications in P. patens by leveraging the moss's exceptional homologous recombination capability:

Design Strategy for Efficient Editing:

  • sgRNA Selection: Design sgRNAs targeting psbB with minimal off-target effects. For P. patens psbB, the optimal sgRNAs typically target exon regions with GC content between 40-60%. Multiple bioinformatic tools can predict sgRNA efficiency specifically for P. patens.

  • Donor DNA Template Selection: For psbB modifications, researchers can employ various donor templates:

    • Single-strand DNA or double-strand DNA oligos for point mutations

    • Linearized plasmids for larger insertions or replacements

    • Circular plasmids for complex modifications

These templates achieve 28-100% editing efficiency depending on design .

  • Transformation Protocol Optimization:

    • Co-transform CRISPR-Cas9 components (plasmids harboring Cas9 and sgRNAs) with donor DNA templates into moss protoplasts

    • Maintain an optimal molar ratio between Cas9/sgRNA plasmids and donor templates (typically 1:3)

    • Use PEG-mediated transformation with 5-10 μg of total DNA

  • HDR Enhancement Strategies:

    • Design donor templates with homology arms of 50-80 bp for small modifications

    • Extend homology arms to 500-1000 bp for larger modifications

    • Include selection markers flanked by loxP sites for subsequent removal

What analytical techniques are most effective for studying psbB protein-protein interactions within the photosystem complex?

Several advanced analytical techniques provide valuable insights into psbB protein-protein interactions within the photosystem complex:

  • Cross-linking Mass Spectrometry (XL-MS): This technique identifies spatial relationships between proteins in the photosystem complex by using homobifunctional crosslinkers like BS3 (with 11.4 Å spacer arm length) . Crosslinked peptides are analyzed using ESI-MS/MS spectrometry and identified with specialized software such as MassMatrix and pLink. This approach has successfully mapped interactions in photosystem proteins, revealing residues that are within specific distances of each other.

  • Two-dimensional Electronic Spectroscopy (2DES): This cutting-edge technique elucidates electronic structure and dynamics on a femtosecond timescale, providing insights into energy transfer within the photosystem complex . Recent advances allow 2DES experiments to be conducted in seconds, acquiring thousands of spectra and permitting analysis of highly scattering samples including whole cells.

  • X-ray Crystallography and X-ray Free Electron Laser (XFEL) Studies: These techniques provide structural information about psbB and its interactions within PSII. XFEL studies are particularly valuable as they avoid radiation damage to the sensitive manganese cluster of PSII by using sub-50 fs X-ray pulses . Combined X-ray emission spectroscopy (XES) and X-ray diffraction (XRD) measurements can simultaneously track structural and electronic changes.

  • Fluorescence-based Techniques: Specialized setups allow simultaneous measurement of chlorophyll fluorescence and blue-green fluorescence (NADPH), providing insights into electron transfer processes involving psbB .

  • Cryo-electron Microscopy: This technique has revolutionized structural studies of membrane protein complexes and is particularly valuable for examining psbB's interactions within the native PSII complex.

Each of these techniques provides complementary information about how psbB interacts with other components of the photosynthetic machinery, allowing researchers to build comprehensive models of its function in energy transfer and electron transport processes.

How does photoheterotrophic growth affect psbB expression and function in P. patens?

Photoheterotrophic growth conditions significantly impact psbB expression and function in Physcomitrella patens through several mechanisms:

Under photoheterotrophic conditions (growth on media containing sucrose in the presence of DCMU, which inhibits PSII function), P. patens shows distinct physiological adaptations . Recent research has successfully isolated P. patens strains capable of photoheterotrophic growth, overcoming previous limitations in photosynthesis research with this model organism .

Effects on psbB Expression:

  • Transcriptional Regulation: Under photoheterotrophic conditions, psbB transcription is typically downregulated as the functional need for PSII components decreases. Quantitative PCR analyses show a 30-60% reduction in psbB transcript levels compared to photoautotrophic conditions.

  • Post-transcriptional Control: Despite reduced transcription, some psbB protein remains present due to altered turnover rates and post-transcriptional regulatory mechanisms that help maintain minimal PSII function.

Effects on psbB Function:

  • Altered Protein Associations: Mass spectrometry analyses reveal modified interactions between psbB and other PSII components, likely representing adaptation to reduced electron transport through PSII.

  • Structural Modifications: Spectroscopic analyses indicate subtle structural changes in the CP47 protein under photoheterotrophic conditions, potentially affecting chlorophyll orientation and energy transfer efficiency.

  • Redox State Impacts: The altered redox environment under photoheterotrophic growth affects post-translational modifications of psbB, influencing its stability and functional properties.

These findings have significant implications for experimental design when studying psbB function, as researchers must carefully consider how growth conditions might influence experimental outcomes and interpretation of results. The ability to maintain P. patens under photoheterotrophic conditions opens new experimental possibilities for studying essential photosynthetic proteins like psbB.

What is the recommended protocol for purifying recombinant P. patens psbB protein?

The purification of recombinant P. patens psbB protein requires specialized techniques due to its membrane-associated nature. Based on established protocols for similar photosystem proteins, the following optimized procedure is recommended:

Purification Protocol for Recombinant P. patens psbB:

  • Cell Lysis and Membrane Fraction Isolation

    • Harvest cells expressing His-tagged recombinant psbB

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 200 mM NaCl, 1 mM EDTA, protease inhibitor cocktail)

    • Disrupt cells via sonication or French press

    • Centrifuge at 10,000 × g for 10 minutes to remove debris

    • Ultracentrifuge supernatant at 100,000 × g for 1 hour to isolate membrane fraction

  • Membrane Protein Solubilization

    • Resuspend membrane pellet in solubilization buffer (20 mM Tris-HCl pH 8.0, 300 mM NaCl, 5% glycerol)

    • Add n-dodecyl-β-D-maltoside (DDM) detergent to 1% final concentration

    • Incubate with gentle rotation at 4°C for 1 hour

    • Ultracentrifuge at 100,000 × g for 30 minutes to remove insoluble material

  • Affinity Chromatography

    • Apply solubilized protein to Ni-NTA resin equilibrated with binding buffer (20 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDM, 5% glycerol, 20 mM imidazole)

    • Wash extensively with binding buffer

    • Elute protein with elution buffer (binding buffer with 250 mM imidazole)

  • Size Exclusion Chromatography

    • Apply eluate to Superdex 200 column equilibrated with SEC buffer (20 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 5% glycerol)

    • Collect fractions and analyze by SDS-PAGE

  • Storage

    • Concentrate protein using 50 kDa cutoff concentrators

    • Add 6% trehalose for stability

    • Flash freeze in liquid nitrogen and store at -80°C

Quality Control Assessments:

  • Protein purity by SDS-PAGE (>90% purity expected)

  • Western blot using anti-His antibodies

  • Circular dichroism to verify secondary structure

  • Chlorophyll content determination by spectroscopy

For long-term storage, aliquot the purified protein and add glycerol to a final concentration of 5-50% before storage at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What techniques are available for measuring chlorophyll fluorescence to assess psbB function?

A variety of specialized techniques are available for measuring chlorophyll fluorescence to assess psbB function in P. patens, providing insights into photosystem II activity and energy transfer processes:

Standard Fluorescence Techniques:

  • Pulse-Amplitude Modulation (PAM) Fluorometry:

    • Measures chlorophyll fluorescence yield under different light conditions

    • Calculates key parameters: Fv/Fm (maximum quantum yield), ΦPSII (effective quantum yield), NPQ (non-photochemical quenching)

    • Protocol involves dark-adapting samples (15-30 minutes), measuring F0 (minimal fluorescence), applying saturating pulse to measure Fm (maximal fluorescence), and calculating Fv/Fm ratio

    • Particularly useful for assessing psbB mutant phenotypes

  • Fast Chlorophyll Fluorescence Induction (OJIP Test):

    • Captures fluorescence rise from O (minimal) to P (peak) through intermediate J and I steps

    • Provides detailed information about electron transport kinetics within PSII

    • Particularly sensitive to alterations in the CP47 protein (encoded by psbB)

Advanced Fluorescence Techniques:

These techniques provide complementary information about how psbB contributes to PSII function and can be combined to gain comprehensive insights into the consequences of psbB modifications or environmental conditions on photosynthetic performance.

What are the most effective approaches for creating psbB knockouts or mutations in P. patens?

Creating psbB knockouts or mutations in P. patens can be achieved through several highly effective approaches that leverage the moss's exceptional homologous recombination capability:

CRISPR-Cas9 with Donor DNA Templates

This approach represents the current gold standard for psbB modifications due to its precision and efficiency:

  • Method: Co-transform plasmids harboring Cas9 and sgRNAs with donor DNA templates into moss protoplasts

  • Efficiency: Achieves 28-100% of colonies showing expected gene editing

  • Advantages: Creates marker-free knockouts; can generate precise substitutions, deletions, and knock-in tagging

  • Protocol Highlights:

    • Design sgRNAs targeting psbB coding sequence

    • Create donor template with desired modifications flanked by homology arms

    • Transform protoplasts with both components

    • Screen regenerated plants by PCR and sequencing

Traditional Gene Targeting

This established approach relies on P. patens' naturally high homologous recombination frequency:

  • Method: Transform moss with linearized DNA constructs containing homology arms flanking a selection marker

  • Efficiency: Achieves approximately 54% gene targeting efficiency

  • Protocol Highlights:

    • Design construct with 500-1000 bp homology arms flanking selectable marker

    • Linearize plasmid before transformation

    • Transform protoplasts via PEG-mediated transformation

    • Select transformants on appropriate media

Oligodeoxynucleotide (ODN)-Assisted Editing

This approach is particularly useful for introducing specific point mutations:

  • Method: Provide single-strand or double-strand DNA oligos as repair templates during CRISPR-Cas9 editing

  • Advantage: Particularly valuable for creating loss-of-function, gain-of-function, or hypomorphic alleles of essential genes like psbB

Comparative Efficiency Table:

ApproachTargeting EfficiencyMarker-Free PotentialTime RequiredBest Application
CRISPR-Cas9 with donor60% of DSBs repaired via HDR Yes4-6 weeksPrecise modifications
Traditional gene targeting54% efficiency No6-8 weeksComplete knockouts
ODN-assisted editingVariable (28-100%) Yes4-6 weeksPoint mutations

The choice of method depends on the specific experimental goals, but the CRISPR-Cas9 with donor DNA template approach generally offers the best combination of efficiency and precision for most applications involving psbB modifications.

What strategies can researchers use to troubleshoot common issues in psbB expression and purification?

Researchers working with recombinant psbB protein often encounter several challenges during expression and purification. The following troubleshooting strategies address common issues:

Issue 1: Low Expression Levels

ProblemPossible CausesSolutions
Poor protein yieldSuboptimal codon usage- Optimize codons for expression host
- Use specialized strains with rare tRNAs
Protein toxicity- Use tightly regulated inducible promoters
- Reduce induction temperature (16-20°C)
- Try cell-free expression systems
Improper membrane integration- Add signal sequences to improve membrane targeting
- Test different expression hosts (E. coli C41/C43)

Issue 2: Protein Aggregation/Inclusion Bodies

ProblemPossible CausesSolutions
Protein forms insoluble aggregatesImproper folding- Reduce expression temperature
- Co-express with chaperones
- Add glycerol (5-10%) to growth media
Insufficient detergent- Optimize detergent type and concentration
- Try different detergents (DDM, LMNG, LDAO)
Oxidative damage- Include reducing agents (DTT, β-mercaptoethanol)
- Express under low-oxygen conditions

Issue 3: Purification Challenges

ProblemPossible CausesSolutions
Low binding to affinity resinTag inaccessibility- Change tag position (N vs C-terminus)
- Use longer linkers between protein and tag
Interfering compounds- Modify buffer composition
- Increase imidazole in wash buffers
Poor purityNon-specific binding- Increase salt concentration (300-500 mM NaCl)
- Add low concentrations of competing agents
Protein degradation- Include protease inhibitors
- Maintain samples at 4°C
- Add 6% trehalose for stability

Issue 4: Loss of Chlorophyll During Purification

ProblemPossible CausesSolutions
Loss of associated chlorophyllHarsh purification conditions- Reduce detergent concentration
- Include glycerol (5-20%) in all buffers
Exposure to light- Perform purification in dim light
- Wrap columns and collection tubes in foil
Oxidative damage- Include antioxidants (ascorbate, tocopherol)
- Purge buffers with nitrogen

Optimization Strategy Workflow:

  • Start with small-scale expression tests to identify optimal conditions

  • Perform systematic detergent screening (type and concentration)

  • Optimize buffer components for each purification step

  • Consider adding stabilizing agents (6% trehalose, glycerol)

  • For long-term storage, aliquot protein and avoid freeze-thaw cycles

These troubleshooting strategies can significantly improve the yield and quality of recombinant psbB protein, facilitating downstream structural and functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.