Recombinant Physcomitrella patens subsp. patens Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Biological Role in Photosynthesis

The D2 protein, alongside D1, forms the PSII reaction center, facilitating water splitting and oxygen evolution. Key functions include:

  • Electron Transport: Mediates electron transfer from water to plastoquinone .

  • Photoprotection: Contributes to non-photochemical quenching (NPQ) under high-light stress, a mechanism shared with LHCSR proteins in P. patens .

  • Structural Integrity: Stabilizes the manganese cluster required for water oxidation .

3.1. Stress Response Studies

  • High-Light Adaptation: P. patens mutants lacking PSII-associated proteins show impaired growth under excess light, highlighting psbD’s role in stress resilience .

  • ABA Signaling: PSII proteins indirectly influence abscisic acid (ABA)-mediated growth regulation, as seen in P. patens mutants with altered ABA sensitivity .

3.2. Photosynthetic Mechanism Analysis

  • Proteomic Profiling: Chloroplast proteome studies reveal psbD’s downregulation during protoplast isolation, linking its abundance to photosynthetic efficiency .

  • Evolutionary Insights: P. patens retains both LHCSR- and PSBS-dependent NPQ mechanisms, providing a model for studying PSII evolution .

Comparative Analysis with Homologs

The psbD protein is conserved across plants but shows species-specific variations:

SpeciesUniProt IDLength (aa)Key Differences
Oryza sativa (Rice)P0C43635394% sequence identity; His-tagged for ELISA
Arabidopsis thalianaP56776353Lacks LHCSR coexistence, unlike P. patens

Future Research Directions

  • Gene Editing: Use P. patens’ efficient homologous recombination to generate psbD knockout lines for functional studies .

  • Structural Biology: Cryo-EM analysis of recombinant psbD to resolve PSII architecture in non-vascular plants .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format requirement, kindly indicate it in your order remarks, and we will fulfill your request.
Lead Time
The delivery time may vary based on the purchase method and location. For precise delivery information, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Physcomitrella patens subsp. patens (Moss)
Target Names
psbD
Target Protein Sequence
MTIAIGKSSKEPKGLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFSLGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ SEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLVFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Gene References Into Functions
  1. The moss SIG5 mediates multiple layers of signals to intricately regulate psbD transcription. PMID: 18174028
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Why is Physcomitrella patens used as a model organism for recombinant protein studies?

Physcomitrella patens has emerged as an excellent model for recombinant protein studies primarily due to its remarkably efficient homologous recombination capability. Unlike many plant systems where random integration of foreign DNA is common, P. patens allows for targeted gene replacement through homologous recombination at frequencies much higher than other plant systems . Additionally, its fully sequenced genome, ability to grow in suspension culture, and capacity for targeted knockout mutations for glycoengineering make it a versatile platform for both gene function studies and recombinant protein production .

What genomic features make P. patens chloroplast DNA unique?

The chloroplast genome of P. patens (122,890 bp) contains 83 protein-coding genes, 31 tRNA genes, and 4 rRNA genes. A distinctive feature of the P. patens chloroplast genome is a 71 kb inversion from petD to rpoB, which is not found in other mosses and appears to be restricted to Funariaceae, Disceliaceae, and Encalyptaceae families . Additionally, P. patens lacks several genes found in other bryophytes, including rpoA, cysA, cysT, and ccsA, with the absence of rpoA being characteristic of peristomate-arthrodontous mosses .

How does the gene targeting mechanism work in P. patens?

Gene targeting in P. patens occurs through two main mechanisms:

  • Targeted Gene Replacement (TGR): This involves homologous recombination between the ends of a targeting construct and the targeted locus. The process results in the replacement of the genomic sequence with the transforming DNA .

  • Targeted Insertion (TI): This mechanism involves homologous recombination at one end of the targeted locus with one flanking sequence of the vector, accompanied by non-homologous end-joining (NHEJ) at the other end .

These mechanisms allow for precise genetic manipulation, making P. patens an excellent system for functional genomics studies.

What experimental design approaches optimize recombinant psbD expression in P. patens?

Optimizing recombinant psbD expression in P. patens requires a systematic multivariate experimental design approach. This methodology allows researchers to evaluate multiple variables simultaneously and identify significant factors affecting expression levels. Key variables to consider include:

  • Promoter selection

  • Culture conditions (temperature, light intensity, photoperiod)

  • Media composition

  • Transformation method

  • Selection marker choice

Implementation of factorial designs rather than traditional univariate approaches enables the assessment of interactions between variables and allows for statistical analysis of experimental error . For example, a fractional factorial design could be employed to assess the effects of media composition and light conditions on psbD expression while minimizing the number of experiments required.

How do targeted mutations in psbD affect photosystem II assembly and function in P. patens?

Studies of psbD function can be approached by examining analogous systems. Research in cyanobacteria has shown that mutations in psbD can significantly impact PSII assembly and function. When analyzing the effects of targeted mutations in P. patens psbD, researchers should consider:

  • The relationship between structure and function in D2 protein domains

  • Interactions with other PSII components, particularly CP43

  • Effects on electron transport efficiency

  • Impact on photosynthetic capacity and growth

Analysis techniques should include:

  • Western blot analysis to assess protein abundance

  • Chlorophyll fluorescence measurements to evaluate PSII efficiency

  • Growth measurements under various light conditions

  • Thylakoid membrane isolation and protein complex analysis

What strategies can address the challenge of maintaining proper protein folding when expressing recombinant psbD?

Maintaining proper folding of recombinant psbD is critical for functional studies. Effective strategies include:

  • Optimization of expression conditions: Using experimental design approaches to identify optimal temperature, light conditions, and media composition that promote proper protein folding .

  • Co-expression of chaperones: Introduction of molecular chaperones to assist in proper protein folding.

  • Targeted localization: Ensuring proper targeting to the chloroplast through optimization of transit peptide sequences.

  • Expression timing control: Implementing inducible promoters to control the rate of protein synthesis, allowing sufficient time for proper folding.

  • Post-translational modification considerations: Accounting for P. patens-specific post-translational modifications that may affect protein folding and function.

The success of these strategies should be evaluated through analysis of protein solubility, membrane integration, and functional assays of photosynthetic activity.

How can researchers distinguish between the effects of psbD mutation and other photosystem components in functional studies?

Distinguishing the specific effects of psbD mutations from those of other photosystem components requires careful experimental design:

  • Generation of complementation lines: Creating mutant lines expressing various versions of psbD to demonstrate that phenotypes are specifically due to psbD alteration.

  • Protein complex analysis: Using blue-native PAGE and subsequent immunoblotting to assess the assembly state of PSII complexes.

  • Component-specific spectroscopic measurements: Employing techniques such as time-resolved fluorescence spectroscopy to measure the function of specific photosystem components.

  • Comparative analysis with other photosystem mutants: Assessing phenotypic similarities and differences with mutations in other PSII components.

  • Synthetic genetic approaches: Creating double mutants with alterations in both psbD and other photosystem genes to analyze genetic interactions.

What are the comparative advantages of chloroplast versus nuclear transformation for psbD studies in P. patens?

FeatureChloroplast TransformationNuclear Transformation
Integration mechanismHomologous recombinationBoth homologous recombination and non-homologous end-joining
Expression levelGenerally high due to high copy numberVariable, generally lower than chloroplast
Post-translational processingLimited to chloroplast-specific modificationsMore diverse modification capabilities
Gene dosageMultiple copies per cellTypically single or few copies
Transgene containmentMaternal inheritance limits spreadPotential for spread through spores
Protein targetingNatural location for psbDRequires targeting sequences
Co-expression of operonsPossibleRequires individual promoters

For psbD studies specifically, chloroplast transformation offers the advantage of expressing the protein in its native environment with appropriate processing machinery, while nuclear transformation may be advantageous for studying trafficking and assembly of imported photosystem components .

What are the most effective protocols for confirming successful integration of recombinant psbD in P. patens?

Confirming successful integration of recombinant psbD constructs requires a comprehensive validation approach:

  • PCR verification: Using primers that span the junction between the inserted DNA and the genomic target site to confirm targeted integration.

  • Southern blot analysis: Verifying the correct integration and copy number of the transformed construct.

  • Northern blot analysis: Confirming transcription of the recombinant psbD gene, as demonstrated in studies of dicistronic messages in cyanobacteria .

  • Western immunoblot analysis: Detecting the presence of the D2 protein in thylakoid preparations, with quantitative comparison to wild-type levels .

  • Fluorescent reporter systems: Using fluorescent proteins as visual markers for successful transformation, similar to approaches used for identifying hybrid sporophytes in P. patens crosses .

How can researchers optimize experimental design to enhance soluble expression of recombinant psbD?

Optimizing soluble expression of recombinant psbD requires statistical experimental design methodology that addresses multiple variables simultaneously:

  • Multivariate analysis: Implementing factorial design experiments that evaluate the effects of temperature, light cycles, media composition, and expression time simultaneously .

  • Response surface methodology: Using this approach to identify optimal conditions for maximizing soluble protein yield.

  • Sequential optimization strategy:

    • First phase: Screening significant variables using fractional factorial designs

    • Second phase: Optimizing significant variables using central composite designs

    • Third phase: Validating the optimal conditions

  • Monitoring protein partitioning: Regularly analyzing both soluble and membrane fractions to track protein distribution and solubility.

This methodological approach has been shown to significantly improve soluble protein expression in various recombinant systems, with potential to achieve high yields (>200 mg/L) of functional protein .

What techniques are most reliable for assessing the functional activity of recombinant psbD in P. patens?

Assessing functional activity of recombinant psbD requires multiple complementary approaches:

  • Chlorophyll fluorescence analysis: Measuring PSII quantum yield (Fv/Fm), electron transport rate (ETR), and non-photochemical quenching (NPQ) to assess photosynthetic efficiency.

  • Oxygen evolution measurements: Quantifying oxygen production rates under controlled light conditions.

  • Growth phenotype analysis: Comparing colony size, growth rate, and morphology between wild-type and recombinant lines, similar to observations of reduced colony size in psbD mutants of cyanobacteria .

  • Competition experiments: Conducting mixed-culture experiments between wild-type and recombinant lines to assess relative fitness .

  • Electron microscopy: Examining thylakoid membrane structure and PSII complex assembly.

  • Blue-native PAGE: Analyzing the integration of D2 protein into higher-order PSII complexes.

How can researchers account for the 71 kb inversion in the P. patens chloroplast genome when designing psbD targeting constructs?

The 71 kb inversion from petD to rpoB in the P. patens chloroplast genome requires special consideration when designing psbD targeting constructs:

  • Updated genome maps: Using P. patens-specific chloroplast genome maps that account for the inversion rather than relying on maps from other bryophyte species .

  • PCR verification strategy: Designing primers that can distinguish between inverted and non-inverted arrangements, similar to approaches used to confirm the species-specificity of the inversion .

  • Homology region selection: Carefully selecting homology regions for targeting constructs that account for the altered genomic context resulting from the inversion.

  • Phylogenetic considerations: Accounting for the restricted nature of this inversion (found only in Funariaceae, Disceliaceae, and Encalyptaceae) when extending findings to other moss species .

  • Construct orientation: Ensuring that the orientation of targeting constructs is compatible with the inverted genomic arrangement in P. patens.

What strategies can address low transformation efficiency when working with recombinant psbD in P. patens?

When facing low transformation efficiency with psbD constructs, researchers should consider:

  • Optimizing homology arm length: Ensuring sufficient homology (typically >500 bp) on each side of the construct to facilitate efficient homologous recombination .

  • Reducing concatenation: Implementing strategies to minimize transgene concatenation, which has been identified as a contributor to targeted insertion events rather than clean gene replacement .

  • Protoplast quality: Ensuring high viability of protoplasts prior to transformation through careful isolation and handling.

  • DNA purity and concentration: Using high-quality, supercoiled DNA at optimal concentrations for transformation.

  • Selection strategy: Implementing a two-stage selection process with an initial lower selection pressure followed by increased stringency.

  • Recovery period optimization: Allowing sufficient recovery time before applying selection pressure.

How can researchers differentiate between phenotypes caused by disruption of psbD versus disruption of overlapping genes?

Differentiating between phenotypes caused by psbD disruption versus effects on overlapping genes requires careful experimental design:

  • Complementation with dicistronic constructs: Creating strains expressing dicistronic messages that contain both potentially affected genes, similar to the AMC027 strain created for psbD/psbC studies in cyanobacteria .

  • Targeted gene replacement with preservation of downstream elements: Designing constructs that replace only the target gene while preserving regulatory elements of potentially overlapping genes.

  • Northern blot analysis: Confirming the expression of all potentially affected genes following transformation .

  • Western immunoblot analysis: Verifying the presence and quantity of proteins encoded by potentially affected genes .

  • Independent transgene expression: Expressing potentially affected genes from independent loci to determine if this rescues any observed phenotypes.

What are the most effective approaches for distinguishing between targeted gene replacement and targeted insertion events?

Distinguishing between targeted gene replacement (TGR) and targeted insertion (TI) events requires molecular characterization:

  • PCR-based screening: Designing multiple primer pairs that can differentiate between TGR, TI, and wild-type configurations.

  • Southern blot analysis: Using probes that can distinguish between different integration patterns.

  • Whole-genome sequencing: Employing next-generation sequencing to precisely characterize integration events in complex cases.

  • Junction analysis: Sequencing the junctions between genomic DNA and the integrated construct to determine the nature of the integration event.

  • Copy number analysis: Using quantitative PCR to determine the copy number of integrated constructs, as TI events often involve multiple copies .

These approaches help researchers accurately characterize the precise genetic modifications in their experimental systems, ensuring proper interpretation of subsequent phenotypic analyses.

How might CRISPR/Cas technology be integrated with P. patens' natural homologous recombination to enhance psbD modification?

The integration of CRISPR/Cas technology with P. patens' natural homologous recombination capability presents promising opportunities:

  • Enhanced targeting precision: Using CRISPR/Cas to create targeted double-strand breaks that stimulate homologous recombination at the psbD locus.

  • Multiplex gene editing: Simultaneously targeting multiple components of the photosystem to study complex interactions.

  • Reducing non-homologous end joining: Implementing strategies to temporarily suppress NHEJ pathways during transformation to favor clean homologous recombination events.

  • Inducible genetic modifications: Developing systems for temporal control of psbD modifications to study developmental aspects of photosystem assembly.

  • Base editing without DNA cleavage: Employing CRISPR-based base editors for precise nucleotide changes without introducing double-strand breaks.

What potential exists for using P. patens as a platform for structure-function studies of engineered psbD variants?

P. patens offers significant advantages as a platform for structure-function studies of engineered psbD variants:

  • Eukaryotic processing machinery: Unlike bacterial systems, P. patens provides eukaryotic post-translational modifications and protein quality control mechanisms.

  • Efficient homologous recombination: The high frequency of targeted gene replacement allows for precise introduction of engineered variants .

  • Photosynthetic context: Being a photosynthetic organism, P. patens provides the native environment for functional studies of photosystem components.

  • Evolutionary insights: As a bryophyte, P. patens occupies an important evolutionary position for understanding the development of land plant photosystems.

  • Technical advantages: The ability to grow P. patens in suspension culture facilitates biochemical and structural studies of membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.