Recombinant Physeter macrocephalus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Physeter catodon (Sperm whale) (Physeter macrocephalus)
Target Names
Target Protein Sequence
MSLIHMNVMMAFSMSLVGLLMYRSHLMSALLCLEGMALSLFIFTTLTTLNLHFTLANMAP IILLVFTACEAAIGLALLVMISNTYGTDYVQSLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its fundamental role in cellular metabolism?

MT-ND4L (Mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4L) is a critical component of Complex I in the mitochondrial electron transport chain. This protein plays an essential role in the first step of oxidative phosphorylation, facilitating the transfer of electrons from NADH to ubiquinone. Within mitochondria, MT-ND4L contributes to creating an unequal electrical charge on either side of the inner mitochondrial membrane through the step-by-step transfer of electrons. This electrochemical gradient ultimately provides the energy necessary for ATP production, the cell's primary energy source .

The protein is embedded within the inner mitochondrial membrane as part of the larger Complex I structure. Its function is integral to cellular respiration and energy metabolism, making it a subject of interest in studies of mitochondrial diseases and energy-related cellular processes.

How should researchers properly store and handle recombinant MT-ND4L in laboratory settings?

Proper storage and handling of recombinant MT-ND4L protein is critical for maintaining its integrity and functionality in research applications. Based on standard protocols, the following guidelines should be observed:

  • Storage Temperature: Store the protein at -20°C for routine use. For extended storage, conserve at -20°C or -80°C .

  • Buffer Composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability .

  • Aliquoting Strategy: To minimize freeze-thaw cycles, prepare working aliquots and store them at 4°C for up to one week. Repeated freezing and thawing is not recommended as it can compromise protein integrity .

  • Reconstitution: When working with lyophilized forms, reconstitute in appropriate buffers as specified by the supplier's protocol.

These handling procedures help maintain the structural and functional integrity of the protein for experimental applications.

What is the relationship between MT-ND4L mutations and human disease pathologies?

MT-ND4L mutations have been implicated in several mitochondrial disorders, most notably Leber hereditary optic neuropathy (LHON). The T10663C mutation (also referred to as Val65Ala) in the MT-ND4L gene has been identified in several families with LHON. This mutation changes a single amino acid in the protein, replacing valine with alanine at position 65 .

More recently, research has identified significant associations between MT-ND4L variants and Alzheimer's disease (AD). A comprehensive study analyzing mitochondrial genomes from 10,831 participants in the Alzheimer's Disease Sequencing Project revealed a study-wide significant association between AD and a rare MT-ND4L variant (rs28709356 C>T; minor allele frequency = 0.002; P = 7.3 × 10^-5). The gene-based test for MT-ND4L also showed significant association with AD (P = 6.71 × 10^-5) .

These findings suggest that mutations affecting the function of MT-ND4L may contribute to neurodegenerative diseases through altered mitochondrial function, potentially involving energy production deficiencies or increased oxidative stress.

What experimental approaches are most effective for studying the function of recombinant MT-ND4L in Complex I assembly and activity?

Effective experimental approaches for studying recombinant MT-ND4L function in Complex I include:

  • Recombinant Expression Systems: Expression of tagged recombinant MT-ND4L (such as His-tagged variants) in E. coli or other expression systems allows for purification and subsequent functional studies .

  • Complex I Activity Assays: NADH:ubiquinone oxidoreductase activity can be measured spectrophotometrically by monitoring NADH oxidation at 340 nm in the presence of ubiquinone analogues.

  • Blue Native-PAGE: This technique enables analysis of intact Complex I assembly and can be used to determine if MT-ND4L mutations affect the assembly or stability of the complex.

  • Site-Directed Mutagenesis: Creating specific mutations in recombinant MT-ND4L (such as the disease-associated Val65Ala) allows for direct assessment of how these changes affect protein function.

  • Protein-Protein Interaction Studies: Co-immunoprecipitation or crosslinking approaches can identify interactions between MT-ND4L and other Complex I subunits or mitochondrial proteins.

  • Structural Analysis: Cryo-electron microscopy has become increasingly valuable for determining the structure of membrane proteins like MT-ND4L within the context of larger complexes.

The selection of appropriate experimental approaches should be guided by the specific research questions and available resources.

What are the optimal conditions for reconstitution and functional analysis of recombinant MT-ND4L?

Optimal conditions for reconstitution and functional analysis of recombinant MT-ND4L include:

  • Reconstitution Buffer: Tris-based buffers with pH 8.0 are typically used, often supplemented with 6% trehalose to stabilize protein structure during freeze-thaw cycles .

  • Concentration Range: Reconstitution to a concentration of 0.1-1.0 mg/mL is recommended for most functional assays .

  • Membrane Mimetic Systems: Due to MT-ND4L's highly hydrophobic nature, reconstitution into phospholipid vesicles or nanodiscs may be necessary to maintain proper folding and function.

  • Detergent Selection: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are typically employed when working with mitochondrial membrane proteins.

  • Storage with Cryoprotectants: Addition of glycerol (typically 50% final concentration) helps prevent protein denaturation during storage at -20°C or -80°C .

For functional analysis, it's crucial to carefully control experimental conditions, particularly pH, temperature, and ionic strength, as these factors can significantly impact the activity and stability of mitochondrial proteins.

How can researchers effectively analyze MT-ND4L variants for potential pathogenicity in mitochondrial disorders?

Effective analysis of MT-ND4L variants for potential pathogenicity involves a multi-faceted approach:

  • Variant Frequency Analysis: Comparison of variant frequencies between case and control populations. For example, the rare MT-ND4L variant rs28709356 C>T showed significant association with Alzheimer's disease with a minor allele frequency of 0.002 and a P-value of 7.3 × 10^-5 .

  • Structural Impact Prediction: Computational analysis to predict how amino acid substitutions might affect protein structure and function. Tools such as SIFT, PolyPhen, and mutation-specific structural modeling can be employed.

  • Evolutionary Conservation Analysis: Assessing conservation of the affected residue across species can indicate functional importance.

  • Functional Assays: Measuring the impact of the variant on:

    • Complex I assembly using Blue Native-PAGE

    • NADH:ubiquinone oxidoreductase activity

    • Mitochondrial membrane potential

    • ROS production

    • ATP synthesis rates

  • Cell and Animal Models: Creating cellular or animal models expressing the variant to assess phenotypic effects.

  • Statistical Tests: For population studies, appropriate statistical methods such as the SCORE test for single-variant analysis and SKAT-O for gene-based testing have proven effective .

What techniques enable accurate detection and quantification of MT-ND4L in complex biological samples?

Accurate detection and quantification of MT-ND4L in complex biological samples requires specialized techniques:

  • Western Blotting: Using antibodies specific to MT-ND4L, though this can be challenging due to the protein's small size (98 amino acids) and hydrophobic nature.

  • Mass Spectrometry: Targeted proteomic approaches such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can provide sensitive and specific quantification of MT-ND4L peptides.

  • ELISA: Enzyme-linked immunosorbent assays using recombinant MT-ND4L standards can be employed for quantification in appropriate sample types .

  • Immunohistochemistry/Immunofluorescence: For localization studies in tissue sections or cells.

  • qRT-PCR: For quantification of MT-ND4L mRNA expression levels, recognizing that post-transcriptional regulation may affect protein levels.

  • Next-Generation Sequencing: Targeted sequencing of mitochondrial DNA to identify variants and assess heteroplasmy levels of MT-ND4L mutations.

The choice of technique should be guided by the specific research question, sample type, and required sensitivity and specificity.

How does MT-ND4L dysfunction contribute to neurodegenerative disease pathogenesis?

MT-ND4L dysfunction appears to contribute to neurodegenerative disease pathogenesis through several interconnected mechanisms:

  • Impaired Energy Production: Mutations in MT-ND4L can reduce Complex I activity, compromising ATP production and cellular energy homeostasis. This is particularly detrimental in high-energy-demanding neurons.

  • Increased Oxidative Stress: Dysfunctional Complex I can lead to electron leakage and increased production of reactive oxygen species (ROS), contributing to oxidative damage of cellular components.

  • Altered Calcium Homeostasis: Mitochondrial dysfunction can impair calcium buffering capacity, potentially leading to excitotoxicity in neuronal cells.

  • Mitochondrial Network Fragmentation: Chronic mitochondrial stress can alter mitochondrial dynamics, affecting the balance between fusion and fission processes.

In Alzheimer's disease specifically, the MT-ND4L variant rs28709356 C>T showed a significant association with disease risk (P = 7.3 × 10^-5) . This supports the broader mitochondrial cascade hypothesis of AD, which proposes that mitochondrial dysfunction is an early and significant contributor to disease pathology. The association of MT-ND4L variants with both Leber hereditary optic neuropathy and Alzheimer's disease suggests that this small but crucial component of Complex I may be a nexus point where mitochondrial dysfunction contributes to diverse neurodegenerative conditions .

What are the most effective experimental models for studying MT-ND4L mutations in disease contexts?

Several experimental models have proven effective for studying MT-ND4L mutations in disease contexts:

  • Cybrid Cell Lines: Transmitochondrial cytoplasmic hybrid (cybrid) cells, where patient-derived mitochondria are introduced into mitochondria-depleted cells, allow for the study of MT-ND4L mutations in a controlled nuclear background.

  • CRISPR-Based Mitochondrial Gene Editing: Recently developed approaches for mitochondrial DNA editing can create precise MT-ND4L mutations in cellular models.

  • Patient-Derived Fibroblasts: Primary cells from patients carrying MT-ND4L mutations provide disease-relevant cellular models.

  • iPSC-Derived Neurons: Induced pluripotent stem cells differentiated into neurons offer a more disease-relevant cell type for studying neurodegenerative aspects.

  • Mouse Models: While challenging due to the difficulties in manipulating mitochondrial DNA, some mouse models with Complex I deficiencies can serve as surrogate models.

  • Computational Models: In silico modeling of MT-ND4L structure and function can predict the impact of specific mutations and guide experimental design.

When selecting an experimental model, researchers should consider factors such as the specific mutation being studied, the disease context, the availability of patient samples, and the particular aspect of MT-ND4L function being investigated.

What emerging technologies might enhance our understanding of MT-ND4L function and dysfunction?

Several emerging technologies hold promise for advancing our understanding of MT-ND4L:

  • Cryo-Electron Microscopy: Continued advancements in cryo-EM resolution may allow for more detailed structural analysis of MT-ND4L within the context of Complex I, potentially revealing how specific mutations affect protein-protein interactions and electron transport.

  • Mitochondrial-Targeted CRISPR Technologies: Emerging tools for precise editing of mitochondrial DNA could enable creation of isogenic cell lines differing only in specific MT-ND4L mutations.

  • Single-Cell Omics: Single-cell transcriptomics and proteomics approaches may reveal cell-to-cell variation in responses to MT-ND4L mutations, potentially explaining the selective vulnerability of certain cell types.

  • Live-Cell Imaging of Mitochondrial Function: Advanced microscopy techniques combined with genetically encoded indicators can provide real-time visualization of how MT-ND4L mutations affect mitochondrial membrane potential, ROS production, and calcium handling.

  • Therapeutic Approaches: Development of mitochondrial-targeted antioxidants, gene therapy approaches, or small molecules that can compensate for MT-ND4L dysfunction represent important future directions with clinical relevance.

As these technologies continue to evolve, they promise to provide deeper insights into the fundamental role of MT-ND4L in mitochondrial function and how its dysfunction contributes to human disease.

How might research on sperm whale MT-ND4L inform understanding of mitochondrial adaptations to extreme environments?

Research on Physeter macrocephalus (sperm whale) MT-ND4L offers a unique window into mitochondrial adaptations to extreme environments:

  • Deep-Diving Adaptations: Sperm whales can dive to depths exceeding 2,000 meters and remain submerged for over an hour. Studying their MT-ND4L may reveal adaptations that optimize energy production under high-pressure, low-oxygen conditions.

  • Evolutionary Context: Mitochondrial genome analyses suggest a time to most recent common ancestor (TMRCA) for sperm whales of approximately 126.4-126.5 thousand years ago . This evolutionary timeline provides context for understanding the selective pressures that may have shaped MT-ND4L function.

  • Comparative Energetics: Comparison of sperm whale MT-ND4L with terrestrial mammals may highlight adaptations related to diving physiology, such as enhanced efficiency of electron transport or resistance to oxidative stress during repeated hypoxia-reoxygenation cycles.

  • Temperature Adaptation: Marine mammals like sperm whales maintain high body temperatures in cold environments, suggesting potential adaptations in mitochondrial proteins like MT-ND4L that might optimize function across thermal gradients experienced during deep dives.

Understanding these adaptations could provide insights not only into basic mitochondrial biology but also potentially inform biomedical applications related to ischemia-reperfusion injury, hypoxic conditions, and optimization of energy production under stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.