Recombinant Phytoene dehydrogenase (PDH1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Phytoene Dehydrogenase (PDH1)

Phytoene dehydrogenase (PDH1) is a vital enzyme that participates in the carotenoid biosynthesis pathway in plants . Specifically, it functions as a phytoene desaturase, catalyzing the conversion of phytoene into 3,4-didehydrolycopene through phytofluene and zeta-carotene intermediates . Carotenoids, the products of this pathway, play essential roles in photoprotection, light harvesting, and as precursors for the synthesis of abscisic acid and other signaling molecules .

Recombinant PDH1 refers to the enzyme that is produced using recombinant DNA technology. This involves cloning the PDH1 gene into a suitable expression vector and expressing it in a host organism, such as E. coli, yeast, or plant cells . The recombinant protein can then be purified and used for various research and industrial applications.

Structure and Function of PDH1

The PDH1 enzyme complex consists of multiple subunits that work together to catalyze the conversion of pyruvate to acetyl-CoA .

Each subunit has a specific function :

  • Pyruvate dehydrogenase (E1) Decarboxylates pyruvate and transfers the acetyl group to dihydrolipoamide acetyltransferase (E2) . Thiamine pyrophosphate (TPP) acts as a coenzyme, which helps in the decarboxylation of pyruvate. TPP acts as an electron sink, allowing the acetyl group to transfer to the lipoyllysine arm of the E2 subunit .

  • Dihydrolipoamide acetyltransferase (E2) Contains a lipoic acid cofactor, forming a transient thioester bond with the acetyl group. It transfers the acetyl group to coenzyme A (CoA), creating acetyl-CoA. The flexible lipoyllysine arm transfers the acetyl group from E1 to CoA, which helps the acetyl group transfer to CoA .

  • Dihydrolipoamide dehydrogenase (E3) Catalyzes the reoxidation of the reduced form of the lipoyllysine arm, which allows for subsequent rounds of catalysis .

PDH operates in the mitochondria, linking glycolysis and the citric acid cycle. The conversion of pyruvate to acetyl-CoA by PDH is an important step in energy production because acetyl-CoA enters the citric acid cycle for further oxidation to generate ATP .

Role in Carotenoid Biosynthesis

PDH1 is a critical enzyme in the carotenoid biosynthetic pathway. It catalyzes multiple desaturation steps, converting phytoene to lycopene, a red carotenoid found in tomatoes . These desaturation reactions introduce double bonds into the phytoene molecule, extending the chromophore and resulting in the formation of various carotenoids with distinct colors and functions .

Regulation of PDH1 Expression and Activity

The expression and activity of PDH1 are tightly regulated at the transcriptional and post-translational levels. Several factors influence PDH1 regulation, including light, developmental stage, and environmental cues .

  • Transcriptional Regulation Transcription factors such as PIF1 can directly bind to the PSY promoter to control carotenoid biosynthesis by regulating PSY gene expression .

  • Feedback Inhibition Phytoene synthase (PSY) activity controls the biosynthesis of carotenoids .

Research Findings

Research on PDH has provided insights into its catalytic mechanisms, regulation, and potential applications in biotechnology and metabolic engineering.

  • Proline Metabolism Studies show that altered levels of Proline Dehydrogenase (PDH) can modify free Pro accumulation, which has a limited impact on plant development and growth .

  • PIF1 Binding PIF1 can bind to G-box motifs in the PSY promoter, which regulates PSY gene expression by controlling carotenoid biosynthesis .

Applications of Recombinant PDH1

Recombinant PDH1 has several potential applications:

  1. Metabolic Engineering: Recombinant PDH1 can be used to enhance carotenoid production in plants and microorganisms .

  2. Biotechnology: It can be used in vitro to produce specific carotenoids with industrial applications as pigments, antioxidants, or nutraceuticals .

  3. Understanding Enzyme Function: Studying recombinant PDH1 helps elucidate the enzyme's structure, function, and catalytic mechanisms .

Data Tables

Table 1: Effects of altered Pro levels on Arabidopsis plants

Source of VariationdfMSF
Sense lines
Treatment22,385,448102.08
Sense line3512,95221.95
Interaction T × SL6341,64514.62
Error2123,367
Antisense lines
Treatment240,027,700111.37
Antisense line37,263,85620.21
Interaction T × ASL66,269,29417.44
Error16359,426

df = Degree of freedom, MS = mean of square, P < 0.001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PDH1; Phytoene desaturase; 3,4-didehydrolycopene-forming
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-621
Protein Length
Full Length of Mature Protein
Species
Cercospora nicotianae (Barn spot disease fungus)
Target Names
PDH1
Target Protein Sequence
ARLARAGFHVTVLEKNNFTGGRCSLIHHEGYRFDQGPSLLLLPGLFHRTFAELGTSLEQE GVKLLKCEPNYMIHFSDGEKFTLSSDLSVMKTEVEKWEGKEGYTRYLEFLKESHGHYELS VREVLLRNFEGLTAMLRPEFLRHLLQLHPFESIWTRAGKYFWTERLRRVFTFGSMYMGMS PFDAPGTYSLLQYTELAEGIWYPVGGFHRVVEALVKIGEREGVDFRMETAVKKILLSEDG GVAKGVELEDGRRLEADVVVNNSDLVYAYEKLLPIKTPYAESLKGRPGSCSSISFYWALD RQVPELEAHNIFLADEYRESFDSIFKKHLIPDEPSFYVNVPSRVDSTAAPEGKDSVVVLV PVGHLLEEDRHASQAHQLSASRNGHISSASPPDQPGLTPTEKQDWPAMISLARKTILSTI QSRTNVDLTPLIIHESTNSPLSWKQTFNLDRGAILGLSHSFFNVLCFRPTTRARKPGAFD AQLLKFGVLGRAAEVIIDAFRGRGKDIKGLYMVGASAHPGTGVPICLAGGALVAEQICGD YGVDIPWKEEERKGRDVGGKRKLDVLESPMWLDSWEQWVSVLIYLLVGIFAWLWMKFR
Uniprot No.

Target Background

Function
Phytoene desaturase is an enzyme involved in carotenoid biosynthesis. It catalyzes the conversion of phytoene to 3,4-didehydrolycopene through intermediate steps involving phytofluene, ζ-carotene, neurosporene, and lycopene, introducing up to five double bonds into the phytoene molecule.
Protein Families
Carotenoid/retinoid oxidoreductase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the role of phytoene synthase 1 (PSY1) in carotenoid biosynthesis?

Phytoene synthase 1 (PSY1) functions as the main rate-limiting enzyme in the carotenoid biosynthetic pathway. It catalyzes a critical early step in carotenoid production, which ultimately leads to the synthesis of various carotenoids including phytoene, lycopene, and β-carotene. Research demonstrates that alterations in PSY1 levels directly impact carotenoid accumulation in plant tissues, particularly during fruit ripening. This enzyme represents a key regulatory point for carotenoid accumulation in plants .

How does phytoene desaturase (PDS) function in the carotenoid biosynthetic pathway?

Phytoene desaturase (PDS) catalyzes the introduction of two double bonds into 15-cis-phytoene, yielding 9,15,9'-tri-cis-ζ-carotene via the intermediate 9,15-di-cis-phytofluene. This enzymatic activity represents a critical step in the desaturation sequence required for carotenoid biosynthesis. PDS is also a prominent target for certain inhibitors such as norflurazon, which act as bleaching herbicides by disrupting carotenoid production .

What structural features are important for PSY1 function and regulation?

PSY1 contains several key structural elements critical for its function and regulation:

  • N-terminal chloroplast transit peptide (cTP, amino acids 1-62): Directs the protein to plastids

  • Interaction domain (amino acids 130-238): Required for interaction with regulatory proteins such as PPSR1

  • C-terminal region: Contains two ubiquitination sites at lysine residues (Lys380 and Lys406) that are essential for post-translational regulation

These distinct domains enable proper localization, catalytic activity, and regulatory control of PSY1 in plant cells .

How do recombinant expression systems facilitate the study of carotenoid biosynthetic enzymes?

Recombinant expression systems, such as those used for PDHA1 (though not directly related to carotenoid biosynthesis), provide a model for studying enzymatic proteins. These systems typically involve:

  • Gene insertion into expression vectors with appropriate tags (e.g., 6xHis-GST-tag)

  • Transformation into bacterial cells (e.g., E. coli)

  • Selection of positive transformants using antibiotic resistance

  • Induction of protein expression

  • Affinity purification

  • Quality assessment via methods like SDS-PAGE

This methodological approach enables researchers to obtain purified protein for structural studies, activity assays, and interaction analyses, which is crucial for understanding enzyme function and regulation .

How does ubiquitination affect PSY1 function in carotenoid biosynthesis?

Ubiquitination of PSY1 precursor protein serves as a critical post-translational regulatory mechanism for carotenoid biosynthesis. Research demonstrates that:

  • PSY1 precursor contains two ubiquitination sites at lysine residues (Lys380 and Lys406)

  • The E3 ubiquitin ligase PPSR1 recognizes and interacts with the PSY1 precursor (specifically amino acids 130-238)

  • PPSR1 mediates ubiquitination of PSY1 precursor, targeting it for degradation via the 26S proteasome

  • This degradation affects the steady-state level of PSY1 protein

  • Mutation of either ubiquitination site decreases the degradation rate of PSY1

  • Mutation of both sites further reduces degradation

This regulatory mechanism allows plants to control carotenoid production by modulating PSY1 protein levels post-translationally rather than through transcriptional control .

What evidence supports the role of PPSR1 in regulating PSY1 levels?

Multiple experimental approaches provide strong evidence for PPSR1's role in regulating PSY1:

  • Genetic evidence:

    • PPSR1 mutant lines (ppsr1-4, ppsr1-10, ppsr1-13) show accelerated fruit ripening and increased carotenoid content

    • PSY1 protein levels are approximately 3-fold higher in ppsr1 mutants compared to wild-type

  • Biochemical evidence:

    • PPSR1 demonstrates self-ubiquitination activity characteristic of E3 ligases

    • Yeast two-hybrid assays confirm direct interaction between PPSR1 and the PSY1 protein (specifically amino acids 130-238)

    • Co-expression studies show decreased PSY1-HA levels when co-expressed with Flag-PPSR1

    • Proteasome inhibitor MG132 rescues PSY1 from PPSR1-mediated degradation

    • Cycloheximide chase assays demonstrate faster PSY1 degradation when co-expressed with PPSR1

  • Protein modification analysis:

    • Mass spectrometry identified ubiquitinated lysine residues in PSY1

    • Quantitative proteomics revealed differential protein accumulation in ppsr1 mutants

What techniques are employed to study protein-protein interactions between PSY1 and its regulatory proteins?

Researchers employ multiple complementary techniques to examine PSY1 interactions:

  • Yeast Two-Hybrid (Y2H) analysis:

    • Used to identify direct protein-protein interactions

    • Demonstrated interaction between PPSR1 and PSY1 amino acids 130-238

    • Required removal of chloroplast transit peptide for successful analysis

  • Co-expression studies:

    • Expression of tagged proteins (e.g., PSY1-HA, Flag-PPSR1) in Nicotiana benthamiana

    • Western blot analysis to detect protein levels and stability

  • Protein stability assays:

    • Cycloheximide (CHX) chase assays to monitor protein degradation rates

    • Proteasome inhibitor (MG132) treatments to confirm degradation mechanism

  • Site-directed mutagenesis:

    • Mutation of specific ubiquitination sites (Lys380R, Lys406R) to confirm their functional significance

How can quantitative proteomics be utilized to identify substrates of E3 ligases in carotenoid biosynthesis research?

Quantitative proteomics provides powerful tools for identifying E3 ligase substrates:

  • iTRAQ (isobaric tags for relative and absolute quantification):

    • Labels proteins from different samples with distinct isotopic tags

    • Enables simultaneous identification and quantification of proteins

    • Identified 288 differentially expressed proteins in ppsr1 mutants

    • Detected higher levels of carotenoid biosynthetic enzymes (PSY1, CRTISO, PDS)

  • Ubiquitinome analysis:

    • Enrichment of ubiquitinated peptides containing diGly remnants

    • Mass spectrometry analysis to identify ubiquitination sites

    • Identified 24 diGly peptides with lower abundance in ppsr1 mutants

    • Detected two ubiquitinated lysine residues (Lys380 and Lys406) in PSY1

  • Data integration approach:

    • Correlation of proteins with altered abundance and ubiquitination status

    • Focus on proteins with increased levels but decreased ubiquitination in mutants

    • Identification of potential direct substrates (PSY1, E8, ADH2, etc.)

What controls should be included when studying post-translational regulation of carotenoid biosynthetic enzymes?

Robust experimental design requires multiple controls:

  • Genetic controls:

    • Multiple independent mutant lines (e.g., ppsr1-4, ppsr1-10, ppsr1-13)

    • Wild-type plants grown under identical conditions

    • Isogenic background for all comparisons

  • Expression controls:

    • Transcript level analysis (qRT-PCR) to distinguish post-translational from transcriptional effects

    • Empty vector controls in recombinant expression studies

  • Protein stability controls:

    • Proteasome inhibitor (MG132) treatments

    • Translation inhibitor (cycloheximide) treatments

    • Mutation of ubiquitination sites as negative controls

  • Developmental stage controls:

    • Comparison of equivalent developmental stages (e.g., 34 DPA)

    • Time course analysis to account for developmental differences

How should researchers select appropriate developmental stages for studying carotenoid biosynthesis in fruits?

Selection of developmental stages requires careful consideration:

  • Define clear developmental markers:

    • Days post-anthesis (DPA) provides a standardized timeline

    • Visual color changes should be documented (e.g., green to orange transition)

    • Early color change stages (34-38 DPA in tomato) capture initial carotenoid accumulation

  • Account for genotypic differences:

    • Mutants may exhibit accelerated ripening (e.g., ppsr1 mutants show color change at 34 DPA while wild-type remains green)

    • Compare equivalent physiological stages rather than calendar age when possible

  • Sample multiple timepoints:

    • Capture pre-ripening, transition, and fully ripened stages

    • Monitor specific carotenoid levels (phytoene, lycopene, β-carotene) at each stage

  • Control for environmental factors:

    • Standardize growth conditions (light, temperature, humidity)

    • Consider position effects on fruit development

What statistical approaches are appropriate for analyzing carotenoid content data in mutant studies?

Statistical ApproachApplicationKey Considerations
Student's t-testComparing two groups (e.g., wild-type vs. mutant)Ensure normal distribution and equal variance
ANOVA with post-hoc testsComparing multiple groups or treatmentsControl for multiple comparisons (e.g., Tukey's HSD)
False Discovery Rate (FDR)Proteomics and ubiquitinome dataSet appropriate threshold (e.g., global FDR < 1%)
Biological replicatesAll experimentsMinimum n=3, independent samples
Technical replicatesAnalytical measurementsAccount for measurement variation
Fold-change analysisProtein abundance changesTypically use log2 fold change with significance threshold
Significance thresholdsStatistical testingTypically p < 0.05 or adjusted p-values

Researchers should clearly report statistical methods, sample sizes, and significance thresholds for all quantitative analyses .

How can researchers integrate proteomics and transcriptomics data to understand post-translational regulation mechanisms?

Multi-omics integration requires systematic analytical approaches:

  • Correlation analysis:

    • Compare protein abundance with transcript levels

    • Identify discordant patterns (e.g., increased protein without increased transcript)

    • PSY1 showed ~3-fold protein increase in ppsr1 mutants with no significant transcript change

  • Pathway enrichment:

    • Identify biological processes enriched in differentially expressed proteins

    • Compare with transcriptional changes in the same pathways

  • Post-translational modification mapping:

    • Overlay ubiquitination sites with protein structural features

    • Connect modification sites to protein stability and function

  • Temporal analysis:

    • Track changes across developmental stages

    • Identify sequential regulatory events

  • Validation experiments:

    • Confirm key findings with targeted experiments

    • Test causal relationships with genetic manipulations

Beyond PSY1, what other potential targets of PPSR1 warrant investigation?

Analysis suggests multiple promising targets for future research:

  • E8 protein:

    • Homolog of 1-aminocyclopropane-1-carboxylate oxidase (ACO)

    • Essential for ethylene biosynthesis

    • Contains two ubiquitinated lysine residues

    • Marker gene for tomato fruit ripening

    • Potential indirect regulator of carotenoid biosynthesis via ethylene signaling

  • Additional candidates identified by proteomics:

    • Alcohol dehydrogenase 2 (ADH2)

    • Alcohol acetyltransferase (AAT)

    • Monooxygenase FAD-binding protein (FMO)

    • ClpB chaperone (CLPB)

    • Outer membrane lipoprotein blc (BLC)

  • Broader regulatory networks:

    • Ethylene signaling components

    • Other fruit quality traits affected by PPSR1

    • Interconnection between carotenoid biosynthesis and other metabolic pathways

What technological advances would enhance our understanding of carotenoid biosynthetic enzyme regulation?

Several emerging technologies and approaches could advance the field:

  • In vivo protein tracking:

    • Fluorescent protein fusions to monitor real-time localization

    • FRET/BRET systems to detect protein-protein interactions in living cells

    • Optogenetic control of protein degradation

  • Advanced structural biology:

    • Cryo-EM structures of enzyme complexes

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Single-molecule studies of enzyme activity

  • Genome editing approaches:

    • CRISPR-based modification of ubiquitination sites

    • Precise promoter editing for controlled expression

    • Base editing for specific amino acid substitutions

  • Systems biology integration:

    • Multi-omics data integration across developmental stages

    • Mathematical modeling of carotenoid biosynthetic flux

    • Network analysis of post-translational regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.