Recombinant Phytophthora infestans NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND4L; NAD4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Phytophthora infestans (Potato late blight fungus) (Botrytis infestans)
Target Names
ND4L
Target Protein Sequence
MSILNHFIFTFFLFCLGLFGIILNRQNIIIILMSIELLLLSINLNFIYFAVLIDDIIGQV FSLLILTVAAAESAIGLAIMIVFFKLYGDISIYKINLLSL
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly necessary for enzymatic activity. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How can researchers effectively express and purify recombinant P. infestans ND4L?

Expression and purification of highly hydrophobic membrane proteins like ND4L requires specialized techniques:

  • Expression system selection: E. coli has been successfully employed for recombinant expression of P. infestans ND4L with N-terminal His-tags . Use bacterial strains optimized for membrane protein expression (C41, C43, or Lemo21).

  • Protocol optimization:

    • Culture in Terrific Broth at lower temperatures (16-18°C) after induction

    • Use lower IPTG concentrations (0.1-0.5 mM) to prevent inclusion body formation

    • Add 0.5-1% glycerol to the culture medium to enhance membrane protein folding

  • Purification approach:

    • Solubilize membrane fraction with mild detergents (DDM, LDAO)

    • Use immobilized metal affinity chromatography with imidazole gradient elution

    • Follow with size exclusion chromatography in detergent-containing buffer

  • Storage considerations: After purification, maintain protein stability by storing in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided.

What reconstitution methods are appropriate for functional studies of P. infestans ND4L?

For functional reconstitution of purified recombinant ND4L:

  • Sample preparation: Centrifuge lyophilized protein briefly before opening to ensure material is at the bottom of the container .

  • Reconstitution protocol:

    • Dissolve in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage)

    • For membrane protein studies, consider reconstitution into proteoliposomes using phospholipids that mimic the mitochondrial inner membrane composition

  • Functional assay considerations:

    • Activity measurements may require reconstitution of multiple complex I subunits

    • Ubiquinone reduction assays using spectrophotometric methods

    • Proton translocation studies using pH-sensitive fluorescent dyes

Reconstitution approaches should be carefully optimized based on the specific downstream applications and analytical techniques to be employed.

How does the nuclear vs. mitochondrial encoding of ND4L affect its structure and function in different species?

This question explores evolutionary implications of gene transfer between organellar and nuclear genomes:

While P. infestans ND4L remains mitochondrially encoded (like in most eukaryotes), some species like Chlamydomonas reinhardtii have transferred this gene to the nuclear genome (designated as NUO11) . Comparative analysis reveals several adaptive changes:

  • Structural modifications:

    FeatureMitochondrially-encoded ND4LNuclear-encoded ND4L
    HydrophobicityHigherLower
    Transit peptideAbsentPresent (for mitochondrial targeting)
    Codon usageMitochondrialNuclear
    Post-translational modificationsLimitedMore extensive
  • Functional implications:

    • Nuclear-encoded variants show adapted hydrophobicity profiles that facilitate cytosolic synthesis and mitochondrial import

    • Mitochondrial import machinery recognizes specific targeting sequences absent in mitochondrially-encoded versions

    • RNAi experiments in Chlamydomonas demonstrate that nuclear-encoded ND4L remains essential for complex I assembly and function

Researchers investigating P. infestans ND4L should consider these evolutionary adaptations when designing experiments, especially when comparing across species or when expressing the protein in heterologous systems.

What experimental approaches can determine the role of ND4L in complex I assembly and function in P. infestans?

Several complementary approaches can elucidate ND4L's role:

  • RNA interference (RNAi) or CRISPR-based gene suppression:

    • Design constructs targeting ND4L (similar to those used in Chlamydomonas studies)

    • Analyze phenotypic effects on respiratory function

    • Assess complex I assembly using blue native PAGE

  • Site-directed mutagenesis:

    • Introduce specific mutations in conserved residues

    • Express mutant proteins in appropriate systems

    • Analyze impact on complex I assembly and function

  • Structural analysis:

    • Cryo-EM of isolated complex I with and without ND4L

    • Cross-linking studies to identify interacting partners

    • Molecular dynamics simulations to predict conformational changes

  • Functional assays:

    • NADH:ubiquinone oxidoreductase activity measurements

    • Proton pumping efficiency determination

    • ROS production quantification under various conditions

Research in Chlamydomonas has demonstrated that the absence of ND4L prevents the assembly of the 950-kDa whole complex I and suppresses enzyme activity , suggesting that similar approaches in P. infestans would yield valuable insights into respiratory chain organization in this important plant pathogen.

How can researchers address challenges in studying stop codon usage and translation termination in P. infestans ND4L?

Efficient translation termination is critical for proper protein expression:

  • Stop codon analysis methodology:

    • Analyze codon usage patterns in highly expressed P. infestans genes

    • Compare TAA, TAG, and TGA frequencies in the genome

    • Evaluate the context surrounding the stop codon in ND4L mRNA

  • Experimental approaches:

    • Construct expression vectors with alternative stop codons (TAA, TAG, TGA)

    • Measure protein expression efficiency and accuracy of termination

    • Assess the impact of the termination context (nucleotides surrounding the stop codon)

  • Termination efficiency measurement:

    • Use dual reporter systems to quantify readthrough rates

    • Apply ribosome profiling to assess ribosome occupancy at termination sites

    • Implement mass spectrometry to detect extended protein variants

These approaches are particularly relevant when considering that stop codon reassignment occurs in some organisms , and highly expressed genes often show compositionally and structurally consistent translation termination signals that enhance efficiency.

What experimental design considerations are essential when studying the interactions between P. infestans ND4L and other complex I components?

Investigating protein-protein interactions within complex I requires careful experimental design:

  • Protein-protein interaction methodologies:

    • Co-immunoprecipitation with antibodies against ND4L or other complex I subunits

    • Yeast two-hybrid assays (with modifications for membrane proteins)

    • Bimolecular fluorescence complementation for in vivo studies

    • Chemical cross-linking coupled with mass spectrometry

  • Controls and validation approaches:

    • Use multiple complementary techniques to confirm interactions

    • Include non-interacting proteins as negative controls

    • Validate interactions through mutational analysis of interface residues

  • Experimental design considerations:

    FactorConsiderationImplementation
    Protein hydrophobicityND4L's high hydrophobicityUse specialized interaction assays for membrane proteins
    Detergent selectionMaintaining native interactionsScreen multiple detergents at minimal effective concentrations
    Expression levelsAvoiding artifactsEmploy inducible or native promoters for physiological expression
    Complex assemblyQuaternary structure integrityAnalyze interactions in assembled complex vs. individual components

When designing quasi-experimental approaches, researchers should treat given situations as controlled experiments even when not wholly by design , carefully manipulating variables like expression conditions while monitoring effects on complex I assembly and function.

How might structural insights into P. infestans ND4L inform novel strategies for controlling late blight disease?

Understanding ND4L's structure and function has significant pathogen control implications:

  • Structure-based drug design approaches:

    • Identify unique structural features of P. infestans ND4L compared to host proteins

    • Develop computational models to screen for selective inhibitors

    • Design molecules that disrupt complex I assembly without affecting host respiration

  • Methodological considerations for target validation:

    • Generate resistant mutants to confirm mechanism of action

    • Employ metabolic flux analysis to characterize effects on pathogen bioenergetics

    • Develop assays to measure inhibitor effects on complex I function in intact mitochondria

  • Translational research pathway:

    • In vitro enzyme inhibition assays

    • Cellular studies in P. infestans cultures

    • Plant infection models to assess efficacy in disease control

The essential nature of complex I for energy metabolism makes ND4L an attractive target for new control strategies, potentially addressing challenges of resistance to current fungicides.

What comparative genomic approaches can resolve evolutionary questions about ND4L in oomycetes?

Evolutionary analysis of ND4L provides context for functional studies:

  • Dataset compilation methodology:

    • Extract ND4L sequences from diverse oomycetes and comparison organisms

    • Align sequences using algorithms optimized for transmembrane proteins

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

  • Analytical approaches:

    • Calculate selection pressures (dN/dS ratios) acting on different protein regions

    • Identify conserved motifs essential for function

    • Map sequence variations onto structural models

  • Genome organization analysis:

    • Compare mitochondrial genome architecture across species

    • Identify potential gene transfer events between mitochondrial and nuclear genomes

    • Analyze synteny of flanking regions to trace evolutionary history

These approaches can address fundamental questions about the evolution of the respiratory chain in this important group of plant pathogens, potentially revealing adaptations related to their parasitic lifestyle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.