Recombinant Picea abies Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-319
Protein Length
Full Length of Mature Protein
Species
Picea abies (Norway spruce) (Picea excelsa)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLAKKPVDIEGPQSVLPNTVFEAVVKIPYDTQMKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIRQKMGNLYFQNYRPNQKNIIVIGPVPG QKYSELVFPILSPDPATDKEAHFLKYPIYLGGNRGRGQIYPDGSKSNNTVYSASATGRVS KILRKEKGGYEITIDNTSDGGQVVDIVPPGPELLISEGELIKVDQPLTNNPNVGGFGQGD AEIVLQDPLRVKGLLLFLASVILAQIFLVLKKKQFEKVQLAEMNL
Uniprot No.

Target Background

Function

Recombinant Picea abies Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what functional role does it serve in Picea abies?

Apocytochrome f, encoded by the petA gene, is the heme-free precursor of cytochrome f, a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Picea abies (Norway spruce). As a gymnospermic plant species, Picea abies relies on this protein for electron transfer between photosystem II and photosystem I during photosynthesis . The apocytochrome refers specifically to the protein before heme attachment, while the mature cytochrome f contains the covalently attached heme group that enables its electron transfer function.

The protein structure includes a characteristic N-terminal domain containing a cysteine-rich motif involved in heme binding. According to available sequence data, the Picea abies Apocytochrome f is composed of 285 amino acids (positions 35-319) and contains the highly conserved CXXCH motif typical of c-type cytochromes, which serves as the heme attachment site . The Norway spruce genome sequencing project revealed that despite its massive genome size (approximately 20 gigabases), Picea abies contains a similar number of genes (28,354) as the much smaller genome of Arabidopsis thaliana .

How is Recombinant Picea abies Apocytochrome f (petA) produced and purified for research applications?

The production of Recombinant Picea abies Apocytochrome f involves heterologous expression in Escherichia coli expression systems. According to available product information, the recombinant protein is produced using the amino acid sequence from positions 35-319 of the native protein (UniProt ID: O47042), and is typically fused to an N-terminal His-tag to facilitate purification .

The methodology for producing this recombinant protein follows these key steps:

  • Gene synthesis and vector construction: The petA gene sequence encoding amino acids 35-319 is optimized for E. coli codon usage and cloned into an expression vector with an N-terminal His-tag.

  • Transformation and expression: The recombinant plasmid is transformed into an E. coli expression host strain, followed by induction of protein expression under optimized conditions.

  • Cell lysis and initial clarification: Bacterial cells are harvested and lysed to release the recombinant protein.

  • Affinity chromatography: The His-tagged protein is purified using immobilized metal affinity chromatography (IMAC), typically with Ni-NTA resin.

  • Further purification: Size exclusion chromatography or ion exchange chromatography may be employed for additional purification if needed.

The final recombinant protein is typically formulated in a Tris-based buffer containing 50% glycerol to maintain stability .

What are the optimal storage and handling conditions for maintaining protein stability?

Maintaining the stability and activity of Recombinant Picea abies Apocytochrome f requires specific storage and handling conditions. Based on product specifications, the recommended protocols are:

Storage conditions:

  • Store the protein at -20°C for regular use

  • For extended storage periods, maintain at -20°C or -80°C

  • The protein is supplied in a stabilizing buffer (Tris-based with 50% glycerol) optimized specifically for this protein

Handling recommendations:

  • Repeated freezing and thawing cycles should be strictly avoided as they can lead to protein denaturation and loss of structural integrity

  • Working aliquots should be prepared and stored at 4°C for up to one week to minimize freeze-thaw cycles

  • When preparing experiments, allow the protein to thaw completely at 4°C before use

These conditions help preserve the native conformation of the protein and prevent degradation, ensuring reliable experimental outcomes in research applications.

What genomic context surrounds the petA gene in Picea abies and how does this compare to other plant species?

The petA gene in Picea abies exists within an interesting genomic context. According to the Norway spruce genome sequencing project, Picea abies possesses a massive 20-gigabase genome, which is approximately 100 times larger than that of Arabidopsis thaliana, despite having a similar number of protein-coding genes (around 28,354) .

Unlike many angiosperm genes, gymnosperm genes like those in Picea abies often contain numerous long introns. The Norway spruce genome sequencing project identified introns exceeding 10,000 base pairs in many genes, with the longest intron in high-confidence genes reaching 68 kb. While we don't have specific data on the intron structure of the petA gene from the search results, this pattern of long introns is characteristic of the Picea abies genome .

A notable feature of the Picea abies genome is that its large size appears to result not from whole genome duplication, but rather from the slow and steady accumulation of transposable elements, particularly long terminal repeat retrotransposons (LTR-RTs). This contrasts with many angiosperm species that have undergone recent whole genome duplication events .

The chloroplast genome of Picea abies (approximately 124 kb) shows considerable structural variation within the genus Picea, suggesting evolutionary divergence in the organization of photosynthetic genes, potentially including petA .

What experimental approaches are most effective for studying the function of Recombinant Picea abies Apocytochrome f in photosynthetic electron transport?

Investigating the functional properties of Recombinant Picea abies Apocytochrome f in photosynthetic electron transport requires specialized experimental approaches that address both its structural features and electron transfer capabilities. Effective methodological strategies include:

  • Reconstitution into proteoliposomes: Incorporate the purified recombinant protein into artificial lipid vesicles to study its membrane association and orientation. This typically involves:

    • Preparing liposomes with lipid compositions mimicking thylakoid membranes

    • Insertion of the recombinant protein using detergent-mediated reconstitution

    • Verification of correct orientation using protease protection assays

  • Heme attachment studies: Convert the apocytochrome to the functional cytochrome by:

    • In vitro heme attachment using either chemical methods or enzymatic systems from E. coli or chloroplasts

    • Monitoring the conversion spectroscopically (appearance of characteristic absorption peaks)

    • Assessing conformational changes upon heme incorporation using circular dichroism

  • Electron transfer kinetics measurements:

    • Flash photolysis techniques coupled with absorption spectroscopy

    • Electrochemical measurements to determine redox potentials

    • Construction of minimal electron transfer systems with purified photosystem I and plastocyanin components

  • Interaction studies with partner proteins:

    • Surface plasmon resonance (SPR) to measure binding kinetics with plastocyanin

    • Co-immunoprecipitation assays to identify binding partners

    • Chemical cross-linking followed by mass spectrometry to map interaction interfaces

These methodologies must be adapted specifically for the conifer protein, as its properties may differ from better-studied angiosperm counterparts.

How can Recombinant Picea abies Apocytochrome f be used to investigate evolutionary relationships among gymnosperms?

Recombinant Picea abies Apocytochrome f represents a valuable tool for evolutionary studies, particularly for understanding photosynthetic adaptation in gymnosperms. Methodological approaches for such investigations include:

  • Comparative sequence and structure analysis:

    • Alignment of Apocytochrome f sequences across gymnosperm species to identify conserved and divergent regions

    • Construction of phylogenetic trees based on sequence similarities

    • Homology modeling of protein structures to identify evolutionary conservation of functional domains

  • Functional complementation studies:

    • Expression of Picea abies Apocytochrome f in cytochrome f-deficient mutants of model organisms

    • Quantification of complementation efficiency across evolutionary distance

    • Identification of species-specific functional constraints

  • Experimental evolution approaches:

    • Site-directed mutagenesis to introduce ancestral amino acid states

    • Measurement of functional consequences of evolutionary substitutions

    • Reconstruction of the evolutionary trajectory of electron transfer efficiency

The Norway spruce genome project revealed that conifers appear to lack recent whole-genome duplications, unlike many angiosperm lineages. Instead, their genome expansion resulted from transposable element accumulation, which may have influenced the evolution of genes like petA . Comparative studies using recombinant Apocytochrome f can help elucidate how photosynthetic electron transport has adapted to different environments throughout gymnosperm evolution.

What challenges are associated with expressing and purifying functional Recombinant Picea abies Apocytochrome f?

The expression and purification of Recombinant Picea abies Apocytochrome f presents several technical challenges that researchers must address through specialized methodological approaches:

  • Codon usage optimization:

    • Gymnosperm genes contain codon preferences that differ from E. coli

    • Methodology: Synthesize a codon-optimized gene sequence based on E. coli codon usage tables

    • Assessment: Compare expression levels between native and optimized sequences

  • Membrane protein solubility issues:

    • The C-terminal transmembrane domain can cause aggregation

    • Methodology: Express truncated versions lacking the transmembrane domain or use fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Assessment: Conduct solubility screening with different constructs and expression conditions

  • Disulfide bond formation:

    • The CXXCH motif contains cysteines that may form incorrect disulfide bonds in E. coli cytoplasm

    • Methodology: Express in E. coli strains with modified redox environments (e.g., Origami, SHuffle) or in the periplasm

    • Assessment: Analyze disulfide bond patterns using non-reducing SDS-PAGE and mass spectrometry

  • Purification challenges:

    • Methodology: Implement a two-step purification strategy:
      a) Initial IMAC purification using the His-tag
      b) Polish with size exclusion chromatography to remove aggregates

    • Assessment: Evaluate protein homogeneity by SDS-PAGE, dynamic light scattering, and analytical SEC

  • Protein stability during purification:

    • The protein may be unstable once removed from the membrane environment

    • Methodology: Include appropriate detergents (e.g., DDM, LDAO) or amphipols in all buffers

    • Assessment: Monitor protein stability using thermal shift assays

Current protocols typically use a Tris-based buffer with 50% glycerol for storage, which helps maintain protein stability after purification .

How can site-directed mutagenesis of Recombinant Picea abies Apocytochrome f be utilized to study structure-function relationships?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Recombinant Picea abies Apocytochrome f. A systematic methodological framework includes:

  • Target selection strategy:

    • Identify evolutionarily conserved residues through multiple sequence alignments of cytochrome f sequences across plant species

    • Focus on three primary functional domains:
      a) The heme-binding motif (CXXCH)
      b) The electron transfer interface (residues interacting with plastocyanin)
      c) The membrane anchor domain

  • Mutagenesis experimental design:

    • Generate three categories of mutations:
      a) Conservative substitutions (maintaining physicochemical properties)
      b) Non-conservative substitutions (altering charge, hydrophobicity)
      c) Alanine-scanning of functional interfaces

    Region of InterestConserved ResiduesSuggested MutationsFunctional Impact Analysis
    Heme-binding motifC47, C50, H51C47S, C50S, H51MHeme attachment efficiency
    Plastocyanin interfaceY1, Q2, F3, K86, K187Y1F, K86E, K187AElectron transfer kinetics
    Membrane domainL251-K269Truncations, L251EMembrane association
  • Functional characterization methodology:

    • Heme incorporation assays: UV-visible spectroscopy to measure efficiency of heme attachment

    • Electron transfer kinetics: Laser flash photolysis to measure electron transfer rates

    • Structural stability: Circular dichroism to assess secondary structure changes

    • Binding affinity: Surface plasmon resonance to measure changes in plastocyanin binding

  • Integrative analysis approach:

    • Correlate mutation effects with structural models

    • Compare findings with known structure-function relationships from other plant species

    • Develop predictive models of electron transfer determinants specific to gymnosperm systems

This systematic approach enables researchers to map the functional architecture of Picea abies Apocytochrome f and identify gymnosperm-specific adaptations in photosynthetic electron transport.

What spectroscopic methods are most informative for characterizing Recombinant Picea abies Apocytochrome f?

Comprehensive characterization of Recombinant Picea abies Apocytochrome f requires multiple complementary spectroscopic approaches, each providing distinct structural and functional insights:

  • UV-Visible Absorption Spectroscopy:

    • Methodology: Record spectra from 250-700 nm before and after heme incorporation

    • Information obtained:

      • Apocytochrome f: Primarily protein absorption at 280 nm

      • Holocytochrome f (after heme incorporation): Characteristic Soret band (~410 nm) and α/β bands (520-550 nm)

      • Redox state monitoring through spectral shifts between oxidized and reduced forms

  • Circular Dichroism (CD) Spectroscopy:

    • Methodology: Far-UV (190-250 nm) and near-UV (250-350 nm) measurements

    • Information obtained:

      • Secondary structure composition (α-helix, β-sheet percentages)

      • Tertiary structure fingerprint

      • Conformational changes upon heme incorporation or mutation

  • Fluorescence Spectroscopy:

    • Methodology: Excitation at 280 nm (tryptophan/tyrosine) with emission scanning

    • Information obtained:

      • Tertiary structure through intrinsic fluorescence

      • Conformational changes upon ligand binding

      • Protein folding/unfolding transitions

      • FRET measurements with labeled interaction partners

  • Resonance Raman Spectroscopy:

    • Methodology: Excitation within the Soret band (~410 nm)

    • Information obtained:

      • Heme environment characterization

      • Fe-ligand bond strengths

      • Heme pocket conformational changes

  • EPR Spectroscopy:

    • Methodology: Low-temperature X-band measurements of oxidized cytochrome

    • Information obtained:

      • Electronic structure of the heme iron

      • Axial ligand identification

      • Spin state determination

    Spectroscopic MethodPrimary InformationSample RequirementsAdvantages for Cytochrome Studies
    UV-VisibleHeme incorporation, redox state1-10 μM proteinSimple, non-destructive, quantitative
    Circular DichroismSecondary/tertiary structure0.1-1 mg/mlMonitors conformational changes
    FluorescenceProtein folding, ligand binding0.1-10 μMHighly sensitive, good for kinetics
    Resonance RamanHeme environment details10-100 μMSelective for heme vibrations
    EPRElectronic structure of Fe>100 μM, frozenDetailed electronic configuration

These spectroscopic methods should be applied in combination to build a comprehensive understanding of the structural and functional properties of the recombinant protein.

How can Recombinant Picea abies Apocytochrome f contribute to understanding gymnosperm-specific adaptations in photosynthesis?

Recombinant Picea abies Apocytochrome f serves as a valuable model for investigating gymnosperm-specific photosynthetic adaptations. Methodological approaches to explore this research direction include:

  • Comparative kinetic studies:

    • Measure electron transfer rates between Picea abies cytochrome f and plastocyanin under varying conditions (temperature, pH, ionic strength)

    • Compare with equivalent measurements from angiosperm systems

    • Analyze differences in terms of adaptation to conifer-specific environmental conditions

  • Cold adaptation analysis:

    • Examine temperature-dependent structural stability and activity

    • Identify structural features that contribute to function at lower temperatures typical of conifer habitats

    • Measure activation energies of electron transfer reactions across temperature ranges

  • Long-term evolutionary studies:

    • Integrate findings with the broader context of the Picea abies genome evolution

    • The Norway spruce genome project revealed that conifers have experienced slow and steady accumulation of transposable elements rather than whole genome duplications

    • Investigate how this distinct evolutionary history has shaped the optimization of photosynthetic components

  • Environmental adaptation correlation:

    • Correlate structural and functional properties with the ecological niche of Picea abies

    • Design experiments to test hypotheses about adaptation to specific light conditions, temperature ranges, and seasonal variations

These approaches can reveal how photosynthetic electron transport chains have evolved specifically in gymnosperms to support their survival in environments where they have thrived for over 200 million years .

What bioinformatic approaches can be employed to analyze Picea abies Apocytochrome f in the context of the complete chloroplast genome?

Analyzing Picea abies Apocytochrome f within its genomic context requires sophisticated bioinformatic methodologies that integrate multiple levels of data:

  • Comparative genomic analysis:

    • Methodological approach: Align the chloroplast genomes of Picea abies and related species

    • Target identification: Map syntenic regions surrounding the petA gene

    • Analytical outcome: Identify conserved gene neighborhoods and species-specific rearrangements

    The Norway spruce genome project revealed considerable structural variation within the chloroplast genome (124 kb) among Picea species, suggesting evolutionary divergence in the organization of photosynthetic genes .

  • Transcriptomic integration:

    • Methodological approach: Analyze RNA-Seq data from different tissues and conditions

    • Target identification: Characterize expression patterns of petA alongside other photosynthetic genes

    • Analytical outcome: Identify co-regulated gene clusters and condition-specific expression patterns

  • Regulatory element prediction:

    • Methodological approach: Apply motif discovery algorithms to regions upstream of petA

    • Target identification: Identify putative transcription factor binding sites and RNA-processing signals

    • Analytical outcome: Map the regulatory landscape controlling petA expression

  • Structural variation analysis:

    • Methodological approach: Examine chloroplast genome architecture across populations

    • Target identification: Identify polymorphisms affecting petA and surrounding regions

    • Analytical outcome: Assess the impact of structural variations on gene function and expression

  • Selection pressure analysis:

    • Methodological approach: Calculate dN/dS ratios across cytochrome f sequences

    • Target identification: Map sites under purifying versus positive selection

    • Analytical outcome: Identify functionally critical residues versus adaptive sites

The Picea abies genome project generated over 1 billion RNA-Seq reads, which can be leveraged for these analyses. The project also identified numerous long non-coding RNAs, which might play roles in regulating chloroplast gene expression .

How can Recombinant Picea abies Apocytochrome f be utilized in protein-protein interaction studies involving the photosynthetic electron transport chain?

Investigating protein-protein interactions involving Recombinant Picea abies Apocytochrome f requires sophisticated methodological approaches that capture both transient and stable interactions. A comprehensive experimental framework includes:

  • Surface Plasmon Resonance (SPR) studies:

    • Methodology: Immobilize His-tagged Apocytochrome f on Ni-NTA sensor chips

    • Experimental design: Flow potential interaction partners (plastocyanin, cytochrome b6) across the surface

    • Data analysis: Determine association/dissociation rate constants and binding affinities

    • Control experiments: Compare binding parameters with those from angiosperm cytochromes

  • Crosslinking Mass Spectrometry (XL-MS):

    • Methodology: React the recombinant protein with interaction partners using chemical crosslinkers (BS3, EDC, DSS)

    • Sample processing: Digest crosslinked proteins and analyze by LC-MS/MS

    • Data analysis: Identify crosslinked peptides to map interaction interfaces

    • Model building: Generate structural models of protein complexes based on crosslink constraints

  • Förster Resonance Energy Transfer (FRET):

    • Methodology: Label Apocytochrome f and potential partners with compatible fluorophores

    • Experimental setup: Measure FRET efficiency in solution and in membrane environments

    • Kinetic analysis: Monitor real-time association/dissociation events

    • Competition assays: Use unlabeled proteins to validate specific interactions

  • Co-evolution analysis:

    • Methodology: Apply statistical coupling analysis to aligned sequences

    • Data integration: Correlate co-evolving residues with physical interaction interfaces

    • Validation: Test predictions through site-directed mutagenesis

    Interaction MethodTemporal ResolutionSpatial ResolutionSample RequirementsKey Advantage
    SPRReal-timeNo structural dataPurified proteinsQuantitative kinetics
    XL-MSSnapshot5-30 Å between residuesMicrogram quantitiesMaps interaction interfaces
    FRETMillisecond1-10 nm between probesLabeled proteinsWorks in complex environments
    Co-evolutionEvolutionary timescaleResidue pairsSequence databasesNo experimental manipulation

These complementary approaches provide a comprehensive framework for mapping the interaction network of Apocytochrome f within the photosynthetic machinery of Picea abies.

What are the recommended approaches for investigating post-translational modifications of Picea abies Apocytochrome f?

Investigating post-translational modifications (PTMs) of Picea abies Apocytochrome f requires a multi-faceted analytical strategy combining targeted and untargeted approaches:

  • Mass Spectrometry-Based PTM Mapping:

    • Sample preparation methodology:
      a) In-solution digestion with multiple proteases (trypsin, chymotrypsin, Glu-C)
      b) Phosphopeptide enrichment using TiO2 or IMAC
      c) Glycopeptide enrichment using lectin affinity chromatography

    • Analytical methodology:
      a) High-resolution LC-MS/MS with HCD and ETD fragmentation
      b) Data-dependent acquisition for discovery
      c) Parallel reaction monitoring for targeted verification

    • Data analysis workflow:
      a) Search against custom databases with variable modifications
      b) Manual validation of PTM spectral assignments
      c) PTM site localization scoring

  • Site-Specific Mutagenesis of PTM Sites:

    • Experimental design:
      a) Generate Ser/Thr to Ala mutations at phosphorylation sites
      b) Generate Lys to Arg mutations at ubiquitination sites
      c) Asn to Gln mutations at glycosylation sites

    • Functional assessment:
      a) Heme incorporation efficiency
      b) Electron transfer kinetics
      c) Protein stability and turnover rates

  • PTM-Specific Antibody Detection:

    • Methodology:
      a) Generate or obtain antibodies against common PTMs (phospho-Ser/Thr, acetyl-Lys)
      b) Western blot analysis under various conditions
      c) Immunoprecipitation followed by MS verification

  • In Vitro PTM Reconstitution:

    • Enzymatic modification:
      a) Incubation with plant kinases, acetylases, or other PTM enzymes
      b) Time-course analysis of modification progression
      c) Functional effects of progressive modification

This systematic approach allows researchers to comprehensively characterize the PTM landscape of Picea abies Apocytochrome f and understand how these modifications regulate its function in photosynthetic electron transport.

What are the primary unresolved questions regarding Picea abies Apocytochrome f structure and function?

Despite advances in our understanding of Recombinant Picea abies Apocytochrome f, several critical knowledge gaps remain that warrant future research attention. These unresolved questions include:

  • Gymnosperm-specific structural adaptations: How does the three-dimensional structure of Picea abies cytochrome f differ from angiosperm counterparts, and what functional consequences arise from these differences?

  • Regulatory mechanisms: What transcriptional and post-transcriptional processes regulate petA gene expression in response to environmental stressors common in conifer habitats?

  • Evolutionary trajectory: How has the function of cytochrome f evolved in gymnosperms compared to other plant lineages, particularly in the context of the unique evolutionary history of conifers which lacks recent whole genome duplication events but shows extensive transposable element accumulation ?

  • Integration with the chloroplast genome: How does the organization of the petA gene within the Picea abies chloroplast genome (124 kb) influence its expression and co-regulation with other photosynthetic components ?

  • Functional reconstitution: What conditions are necessary to successfully reconstitute the apocytochrome into a functional holocytochrome with proper heme incorporation in vitro?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.