Recombinant Picea abies Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant Full Length Picea abies Cytochrome b6-f complex subunit 4(petD) Protein, His-Tagged, is expressed in E. coli . It acts as a common linker of electron transport between photosystems I and II in oxygenic photosynthesis .

Cat.No. :RFL6436PF
Product Overview :Recombinant Full Length Picea abies Cytochrome b6-f complex subunit 4(petD) Protein (O47044) (1-178aa), fused to N-terminal His tag, was expressed in E. coli.

Gene Information

The gene name for Recombinant Picea abies Cytochrome b6-f complex subunit 4 (petD) is petD . Other names include Recombinant Cytochrome b6-f complex subunit 4 (petD), Cytochrome b6-f complex subunit 4, and 17 kDa polypeptide .

Protein Details

Recombinant Picea abies Cytochrome b6-f complex subunit 4(petD) Protein has the following specifications:

  • Organism: Picea abies

  • Protein Length: The protein consists of 178 amino acids .

  • Tag: The protein is fused to an N-terminal His tag .

  • Expression: Expressed in E. coli .

  • Purity: Greater or equal to 85% purity as determined by SDS-PAGE .

  • Molecular Weight: The expected apparent molecular weight is 17.4 kDa .

Function and Significance

Cytochrome b6-f complex subunit 4 (petD) is a subunit of the cytochrome b6f complex, which is essential for electron transport in photosynthesis . The cytochrome b6f complex links photosystems I and II, playing a critical role in both linear and cyclic electron transport . Specifically, subunit IV (petD) protrudes from the lumen side of the membrane .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Picea abies (Norway spruce) (Picea excelsa)
Target Names
petD
Target Protein Sequence
MGATKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLSYIFPVVILGTIACTIGLAVLEPS MIGEPANPFATPLEILPEWYLFPVFQILRTVPNKLLGVLLMASVPAGSLTVPFLENVNQF QNPFRRPVATTVSLIGTAVALWLGIGAALPIDESLTLGLFQFDPTVEYKNLSIFYSYI
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, it facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the cytochrome b6-f complex in Picea abies?

The cytochrome b6-f complex in Picea abies, as in other photosynthetic organisms, consists of both large and small subunits. The complex contains four large subunits that organize the electron transfer chain and have counterparts in the cytochrome bc1 complex found in non-photosynthetic bacteria. Additionally, it includes four small subunits that are unique to oxygenic photosynthesis . The complex plays essential roles in both linear and cyclic electron transport pathways, serving as an intermediary electron carrier between photosystem II and photosystem I, while also contributing to the generation of a proton gradient across the thylakoid membrane needed for ATP synthesis.

What experimental approaches can distinguish between the functions of different subunits in the cytochrome b6-f complex?

Researchers can employ several methodological approaches to investigate subunit functions:

  • Gene knockout/mutation studies: Creating targeted mutations in specific subunits (as demonstrated with PetN) to observe the effects on complex stability and function .

  • Functional complementation: Expressing recombinant versions of subunits in mutant backgrounds to restore function.

  • Structural analysis: Using X-ray crystallography or cryo-electron microscopy to determine how subunits interact within the complex.

  • Electron transport measurements: Measuring oxygen evolution activity and electron transfer rates with and without specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone, which can reveal the contribution of specific subunits to electron transport pathways .

  • Fluorescence spectroscopy: Utilizing techniques like 77K fluorescence spectra to assess effects on state transitions and energy distribution between photosystems .

What expression systems are most effective for producing recombinant Picea abies petD protein?

While the search results don't provide specific information about expression systems for recombinant Picea abies petD, researchers typically consider these methodological approaches:

  • Bacterial expression systems: E. coli-based systems modified for membrane protein expression, potentially using specialized strains like C41(DE3) or C43(DE3).

  • Yeast expression systems: Saccharomyces cerevisiae or Pichia pastoris, which offer eukaryotic processing capabilities.

  • Insect cell expression systems: Baculovirus-infected insect cells, which can properly fold complex membrane proteins.

  • Plant-based expression systems: Using model plants like Arabidopsis thaliana or Nicotiana benthamiana for heterologous expression.

The choice of expression system should consider the complex's membrane-associated nature and potential requirements for specific lipid environments and post-translational modifications.

What are the critical factors for successful purification of functional cytochrome b6-f complexes?

Purification of membrane protein complexes like cytochrome b6-f requires careful consideration of:

  • Detergent selection: The choice of detergent is critical for solubilizing the complex while maintaining its structural integrity and function.

  • Buffer composition: Buffers must maintain proper pH and ionic strength, often requiring specific ions (e.g., Mg²⁺) and stabilizing agents.

  • Temperature control: Maintaining low temperatures throughout purification to prevent denaturation.

  • Chromatography methods: Typically combining multiple approaches such as:

    • Affinity chromatography (if tags are incorporated)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Activity preservation: Including components that preserve redox state and cofactor association.

Researchers must validate the functional integrity of purified complexes through activity assays, spectroscopic methods, and structural analyses.

How do environmental stressors affect cytochrome b6-f complex activity in Picea abies?

Norway spruce (Picea abies) employs different physiological strategies to cope with environmental stressors like water deficit. While the search results don't directly connect these responses to the cytochrome b6-f complex, research on photosynthetic parameters provides insights into potential mechanisms:

  • Water deficit responses: Different provenances of Picea abies show variations in biochemical parameters and gas exchange traits under drought conditions .

  • ABA and proline regulation: During drought stress, some provenances primarily increase ABA synthesis while others accumulate proline, suggesting different metabolic regulatory mechanisms for coping with water deficit .

  • Photosynthetic adjustments: Water stress affects stomatal conductance (gS) and net photosynthesis (PN), which are directly connected to electron transport chain function .

These physiological adjustments likely involve regulation of the cytochrome b6-f complex activity, as it serves as a rate-limiting step in electron transport under many conditions.

What methods can detect structural changes in the cytochrome b6-f complex under different physiological conditions?

Researchers can employ several sophisticated techniques to analyze structural changes:

  • Circular dichroism (CD) spectroscopy: To monitor changes in protein secondary structure.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions with altered solvent accessibility under different conditions.

  • Fluorescence resonance energy transfer (FRET): To measure distance changes between labeled components.

  • Small-angle X-ray scattering (SAXS): To detect conformational changes in solution.

  • Time-resolved spectroscopy: To analyze dynamic changes during electron transfer events.

  • Cross-linking coupled with mass spectrometry: To identify interaction interfaces within the complex.

These methods can provide insights into how environmental conditions or genetic variations affect the structural dynamics of the complex.

How variable is the petD gene across different Picea abies populations?

While the search results don't provide specific information about petD variation in Picea abies populations, we can infer potential patterns based on other genetic studies of this species:

  • Geographic variation: Norway spruce shows patterns of genetic variation related to geographic distribution and local adaptation to different climatic conditions .

  • Phenotypic plasticity: Studies suggest high phenotypic plasticity but relatively low signals of local adaptation in some traits in Norway spruce .

  • Transcriptome variation: RNA sequence data from Picea abies (accession PRJEB8220) provides a resource for investigating variation in gene expression, potentially including photosynthesis-related genes .

Researchers investigating petD variation would typically sequence the gene from multiple populations, analyze polymorphisms, and correlate them with environmental variables or phenotypic traits to assess evidence of selection.

What are the molecular evolutionary patterns of the cytochrome b6-f complex across the plant kingdom?

Evolutionary analysis of the cytochrome b6-f complex reveals:

  • Ancient origin: The complex has its evolutionary roots in the cytochrome bc1 complex found in bacteria, with the four large subunits showing homology to bacterial counterparts .

  • Unique adaptations: The four small subunits are unique to oxygenic photosynthesis, representing specialized adaptations for the complex's function in plants and cyanobacteria .

  • Functional conservation: Despite sequence divergence, the electron transfer function has been highly conserved, indicating strong selective pressure.

  • Genome location: In many plants, some cytochrome b6-f complex genes are found in the chloroplast genome (reflecting its endosymbiotic origin), while others may be nuclear-encoded.

Researchers can use comparative genomics and phylogenetic approaches to trace the evolution of petD and other cytochrome b6-f complex components across species.

What spectroscopic techniques are most informative for studying electron transport through the cytochrome b6-f complex?

Researchers employ several specialized spectroscopic methods:

  • Absorption spectroscopy: Monitoring the redox state of cytochromes through their characteristic absorption bands.

  • Electron paramagnetic resonance (EPR): Detecting unpaired electrons in redox centers.

  • Time-resolved spectroscopy: Following the kinetics of electron transfer through different components.

  • 77K fluorescence spectroscopy: Evaluating energy distribution between photosystems and assessing state transitions .

  • Pulse amplitude modulation (PAM) fluorometry: Measuring photosynthetic efficiency and electron transport rates.

These techniques, combined with specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone that target the cytochrome b6-f complex, allow researchers to dissect the complex's role in electron transport pathways .

How can researchers integrate functional and structural data to develop comprehensive models of cytochrome b6-f complex activity?

Modern research approaches combine multiple data types:

  • Integrative structural biology: Combining X-ray crystallography, cryo-EM, NMR, and computational modeling to build complete structural models.

  • Structure-function correlations: Mapping functional data from spectroscopy and biochemical assays onto structural models.

  • Molecular dynamics simulations: Using computational approaches to model dynamic processes like electron transfer and conformational changes.

  • Systems biology approaches: Integrating data on gene expression, protein abundance, and metabolic fluxes to understand the complex's role in the broader context of photosynthesis.

  • Machine learning methods: Developing predictive models of complex function based on multiple experimental datasets.

These integrative approaches help researchers develop comprehensive understanding of how structural features enable the complex's electron transfer function and how this activity is regulated under different conditions.

How might variation in cytochrome b6-f complex function contribute to Norway spruce adaptation to changing climates?

Norway spruce populations show different physiological strategies for coping with environmental stress, which may involve regulation of photosynthetic electron transport:

  • Provenance-specific responses: Different Norway spruce provenances exhibit distinct physiological responses to water deficit, suggesting genetic adaptation to local conditions .

  • Metabolic regulatory mechanisms: Variations in ABA synthesis and proline accumulation between provenances indicate different metabolic strategies for stress response .

  • Photosynthetic adjustments: Changes in stomatal conductance and net photosynthesis rates reflect adaptations in carbon assimilation capacity under stress .

Understanding how the cytochrome b6-f complex contributes to these adaptive responses could inform breeding programs and conservation strategies for Norway spruce under climate change scenarios.

What methodological approaches can assess the relationship between cytochrome b6-f complex function and climate adaptation in conifers?

Researchers can employ several experimental approaches:

  • Common garden experiments: Testing different provenances under controlled conditions to measure photosynthetic parameters related to electron transport .

  • Reciprocal transplant studies: Assessing electron transport capacity and cytochrome b6-f activity across different environments.

  • Ecophysiological measurements: Correlating gas exchange parameters with biochemical analyses of cytochrome b6-f complex abundance and activity .

  • Transcriptomic analyses: Examining expression patterns of genes encoding cytochrome b6-f complex subunits in response to environmental variables .

  • Functional genomics: Using CRISPR or RNAi to modify expression of specific subunits and test effects on stress tolerance.

These approaches can help identify genetic variants of cytochrome b6-f complex components that contribute to climate adaptation in Norway spruce and other conifers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.