Recombinant Picea glauca Casparian strip membrane protein 1

Shipped with Ice Packs
In Stock

Description

Introduction to Casparian Strip Membrane Proteins

Casparian strip membrane domain proteins (CASPs) are specialized four-membrane-span proteins that play a critical role in plant root development. These proteins mediate the deposition of Casparian strips in the endodermis by recruiting the lignin polymerization machinery . The Casparian strip forms a remarkable diffusion barrier in plant roots that functions analogously to tight junctions in animals, controlling the radial flow of water and solutes between the soil environment and the plant vascular system .

CASPs show exceptionally high stability in their membrane domain, displaying all the characteristics of a membrane scaffold. They are initially targeted to the whole plasma membrane before being removed from lateral plasma membranes and becoming exclusively localized at the Casparian strip membrane domain (CSD). At this location, they exhibit extremely low turnover rates, though they are eventually removed .

The significance of these proteins extends beyond their structural role, as they create plasma membrane diffusion barriers and direct the modification of cell walls juxtaposing their membrane domain. By interacting with secreted peroxidases, CASPs mediate the deposition of lignin and the formation of Casparian strips, with these two activities being functionally distinct and separable .

Evolutionary Context of CASP Proteins

CASP-like (CASPL) proteins constitute a large family found across all major divisions of land plants as well as in green algae. Interestingly, homologs outside the plant kingdom have been identified as members of the MARVEL protein family . This widespread distribution indicates the evolutionary importance of these proteins across diverse organisms.

The first extracellular loop (EL1) of CASP proteins shows a particularly interesting evolutionary pattern. This structural feature is highly conserved in euphyllophytes (plants with true leaves) but notably absent in plants lacking Casparian strips. This correlation between the presence of the CASP EL1 signature and the formation of Casparian strips provides valuable insights into the evolution of these specialized root structures .

Research has uncovered that the conserved EL1 region contains a stretch of nine residues that is highly conserved in all spermatophytes (seed plants), suggesting its functional importance . The absence of this conserved region in plants without Casparian strips further strengthens the link between this protein domain and barrier function.

Picea glauca and Lignin Formation

Picea glauca (white spruce) represents an important conifer species in which lignin biosynthesis and cell wall formation have been extensively studied. Recent genomic, transcriptomic, and proteomic analyses have provided deeper insights into lignin biosynthesis in conifers, including Picea glauca .

The lignin-forming capacity of spruce cells involves complex phenolic metabolism pathways that are regulated in part by apoplastic hydrogen peroxide (H₂O₂). Research using Norway spruce cell cultures has demonstrated that extracellular lignin production is linked to oxidative processes in the apoplast. When H₂O₂ is scavenged, coniferin (a glycoside of the monolignol coniferyl alcohol) accumulates in cells, suggesting a direct relationship between apoplastic redox state and lignin polymerization .

Given the role of CASP proteins in organizing lignin deposition in the Casparian strip, the recombinant Picea glauca CASP1 protein provides a valuable tool for investigating the specific mechanisms of barrier formation in conifer roots.

Transmembrane Architecture

CASP proteins feature a four-transmembrane domain architecture that is fundamental to their function. Conservation analysis across the CASPL family has revealed crucial structural elements required for proper localization and function .

The transmembrane domains, particularly TM3, contain highly conserved residues that are essential for protein folding and stability. For instance, when the conserved Asp residue in TM3 (position 134 in Arabidopsis CASP1) was mutated, no functional protein could be detected, suggesting this residue is critical for proper protein folding .

While the search results don't provide specific protocols for recombinant Picea glauca CASP1 production, recombinant expression of membrane proteins typically involves several key considerations:

The expression of four-transmembrane span proteins like CASPs presents significant challenges due to their hydrophobic nature and the necessity of maintaining proper folding. Expression systems must be carefully selected to ensure correct insertion into membranes and proper post-translational modification.

For plant membrane proteins like CASP1, several expression systems may be employed, including:

  1. Bacterial expression systems (E. coli) for high yield but potentially limited post-translational modifications

  2. Yeast expression systems for eukaryotic processing capabilities

  3. Plant-based expression systems for native-like processing

  4. Insect cell expression systems for complex eukaryotic proteins

Purification typically involves detergent solubilization of membranes followed by affinity chromatography, taking advantage of engineered tags such as polyhistidine or GST fusions.

Localization and Dynamics

CASP proteins display a distinctive localization pattern that is critical for their function. They initially target the whole plasma membrane before being quickly removed from lateral plasma membranes to become exclusively localized at the Casparian strip membrane domain (CSD) .

At the CSD, these proteins demonstrate remarkable stability and low turnover, creating a scaffold that serves as a foundation for the deposition of lignin and formation of the Casparian strip. The tight junctions they help form block the apoplastic diffusion between the rhizosphere and the plant vascular system, providing controlled uptake of water and nutrients .

Interaction with Other Proteins

CASPs mediate the deposition of lignin by recruiting the lignin polymerization machinery to specific locations along the cell wall. Through interactions with secreted peroxidases, they direct the polymerization of monolignols into lignin at precise locations .

This protein-protein interaction capability is a defining feature of CASPs, allowing them to serve as organizational hubs for complex cell wall modifications. The interaction between CASPs and peroxidases can occur outside the CSD when CASPs are ectopically expressed, indicating these functions can be uncoupled from their localization .

Comparative Analysis of CASP Homologs

The CASP family shows interesting patterns of conservation and divergence across plant species, providing insights into evolutionary adaptations.

Table 2: Comparative Analysis of CASP Protein Features Across Plant Lineages

Plant GroupEL1 ConservationPresence of Casparian StripsNumber of CASP HomologsFunctional Notes
EuphyllophytesHighPresentMultipleFunctional barrier formation
Picea speciesPresentPresentMultipleAssociated with lignin formation
Mimulus guttatusPresent in 6 homologsPresentAt least 203 with perfect EL1 conservation
Striga asiatica (parasitic)Present but truncatedModified rootsSingle identifiedContains premature stop codon
Utricularia gibba (carnivorous)AbsentAbsent (no true roots)MultipleOnly 2 residues match CASP EL1
Mosses (Physcomitrella)AbsentAbsentPresentDivergent functions

The correlation between the presence of the conserved EL1 stretch and the formation of Casparian strips extends to parasitic plants with modified root anatomy. In the parasitic plant Striga asiatica, which lacks functional roots, a single CASP homolog with a perfectly conserved EL1 signature was identified, but this gene contains a premature stop codon that likely renders it nonfunctional .

In contrast, carnivorous plants like Utricularia gibba, which have no true roots, show a complete loss of the EL1 stretch in their CASP homologs. Despite having over 20 CASP homologs, the closest CASP homolog in U. gibba shows clear divergence of the entire EL1, with only two residues identical to the Arabidopsis CASP EL1 stretch .

Potential Applications and Future Research Directions

Recombinant Picea glauca CASP1 protein offers numerous applications in both fundamental research and applied science:

In fundamental research, this protein can help elucidate the molecular mechanisms of Casparian strip formation in conifers, potentially revealing species-specific adaptations. It may also serve as a tool for studying the evolution of root barrier functions across plant lineages.

For applied research, understanding CASP function could lead to improvements in:

  1. Conifer stress resistance breeding programs

  2. Optimizing nutrient and water uptake in commercially important tree species

  3. Development of trees with enhanced environmental adaptability

  4. Bioengineering of root barrier properties for specialized purposes

Future research directions should focus on determining the three-dimensional structure of conifer CASP proteins, identifying their interaction partners in the lignin biosynthesis pathway, and investigating their regulation under different environmental stresses relevant to forest ecosystems.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Casparian strip membrane protein 1; PgCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Picea glauca (White spruce) (Pinus glauca)
Target Protein Sequence
MMQAESGSAEAKGPLPPPVGRKRRGLGILDFLLRLLAIGATLSAAITMGTTNETLQFFTQ FFQFKARFYDLSAFIYFVIANAIVGGYLLLSLPISILNIVRPRAASSRVFLIFFDTVMVA VCTSGAAAAVAILYVARKGNSRTNWFAICQRFNSFCNQAIGAVSASFAGVVFLILLVLLS ASTLYRRRP
Uniprot No.

Target Background

Function

This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for the formation of the Casparian strip membrane domain (CSD) and subsequent Casparian strip development. Casparian strips are cell wall modifications in the root endodermis, creating an apoplastic barrier between the plant's internal and external apoplasm, thus preventing lateral diffusion.

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Casparian strip and what role does CASP1 play in Picea glauca?

The Casparian strip is a specialized barrier in the endodermal cell walls of plants that regulates the selective uptake of nutrients and water . In Picea glauca (white spruce), as in other plants, CASP1 is a critical membrane protein that mediates the deposition of the Casparian strip by recruiting lignin polymerization machinery . These four-membrane-span proteins form a membrane scaffold at the Casparian strip membrane domain (CSD), creating a diffusion barrier that is essential for controlled nutrient uptake in root tissues .

How does Picea glauca CASP1 compare structurally to CASP proteins in model plants?

Picea glauca CASP1 shares the fundamental four-transmembrane domain structure with other plant CASPs, including the conserved charged residues that are characteristic of the MARVEL/CASP protein family - particularly an Arginine in the first transmembrane domain (TM1) and an Aspartic acid in the third transmembrane domain (TM3) . Based on phylogenetic analysis of CASP homologs, conifer CASPs belong to the same evolutionary lineage as other euphyllophytes (seed plants and ferns) and contain the conserved extracellular loop 1 (EL1) signature that is associated with functional Casparian strips .

What is known about CASP1 localization in Picea glauca tissues?

Research using confocal laser scanning microscopy has revealed the localization of aquaporin proteins (which are often co-expressed with CASPs) in Picea glauca needle cross-sections . While specific CASP1 localization in Picea glauca hasn't been comprehensively documented in the provided sources, immunolocalization techniques similar to those used for aquaporins can be applied to study CASP distribution in conifer tissues . In other plants, CASPs initially target the whole plasma membrane before being removed from lateral plasma membranes to remain exclusively at the Casparian strip membrane domain (CSD) .

What expression systems are most suitable for producing recombinant Picea glauca CASP1?

For recombinant production of Picea glauca CASP1, heterologous expression systems that accommodate membrane proteins are most appropriate. Based on experimental approaches with other plant membrane proteins:

Recommended Expression Systems:

  • Bacterial systems (E. coli): Suitable when using specialized strains designed for membrane protein expression, though proper folding may be challenging

  • Yeast systems (P. pastoris): Often preferred for plant membrane proteins due to better folding capabilities

  • Plant-based expression systems: Using Arabidopsis or tobacco BY-2 cells may provide the most native-like post-translational modifications

The key challenge with CASP proteins is their four-transmembrane structure and the conserved charged residues in TM1 and TM3 that are essential for proper folding. Mutations affecting the conserved Asp residue in TM3 (equivalent to D134H in AtCASP1) have been shown to prevent proper protein expression, suggesting critical structural requirements that must be preserved in recombinant systems .

How can functional recombinant Picea glauca CASP1 be purified and verified?

Purification Protocol:

  • Extract membrane fractions using differential centrifugation

  • Solubilize CASP1 using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Purify using affinity chromatography (via epitope tags)

  • Verify structural integrity using circular dichroism spectroscopy

Functional Verification Methods:

  • Binding assays with known CASP-interacting partners (e.g., peroxidases involved in lignin deposition)

  • Reconstitution into liposomes to assess membrane domain formation

  • Heterologous expression in Arabidopsis casp mutants to test complementation

It's important to note that mutations in conserved residues or structural elements can significantly impact CASP functionality. For example, experimental data with Arabidopsis CASP1 showed that while single mutations in the extracellular loop 2 (EL2) affected localization, complete deletion of either extracellular loop still allowed for CSD localization, though with altered dynamics .

What domains and residues are critical for recombinant Picea glauca CASP1 function?

Based on comparative analysis with other CASP proteins, several structural elements are likely critical for Picea glauca CASP1 function:

Domain/ResidueFunctionEffect of Mutation
Conserved Arg in TM1Membrane anchoring/protein foldingLikely essential for protein stability
Conserved Asp in TM3Protein foldingComplete loss of expression when mutated (D134H in AtCASP1)
Extracellular Loop 1 (EL1)Species-specific function in euphyllophytesDispensable for localization but important for specialized function
Extracellular Loop 2 (EL2)Contributes to localizationMutations affect localization timing and stability; complete deletion delays but doesn't prevent CSD localization
Conserved Cys residues in EL2Potential disulfide bridge formationMutations (C168S, C175S) cause delayed localization at the CSD
Conserved Trp164 in EL2Critical for localizationW164G mutation causes exclusion from CSD

The transmembrane domains, particularly TM1 and TM3 with their conserved charged residues, appear to be the most critical for proper folding and function, while the extracellular loops contribute to fine-tuning localization and specialized functions .

How does the structure of Picea glauca CASP1 relate to its evolutionary history?

Picea glauca CASP1 belongs to the larger CASP/CASPL family that evolved from the MARVEL protein family. The evolutionary relationship is evident through:

  • Conserved transmembrane domains: The four-transmembrane structure with characteristic charged residues in TM1 and TM3 is conserved across plants and relates to MARVEL proteins in other kingdoms .

  • Extracellular loop signatures: The presence of a conserved 9-residue EL1 signature in euphyllophytes (including conifers like Picea glauca) correlates with the presence of Casparian strips . This signature is absent in plants without Casparian strips, such as bryophytes and certain parasitic or carnivorous plants that have lost root functionality .

  • Phylogenetic classification: Picea glauca CASP1 would fall within one of the five CASPL groups identified across land plants, specifically in the group containing functional CASP proteins involved in Casparian strip formation (CASPL1A group) .

This evolutionary context helps explain why certain structural elements are conserved in Picea glauca CASP1 and provides insight into the functional specialization of this protein in conifer root development.

How can recombinant Picea glauca CASP1 be used to study conifer root development?

Recombinant Picea glauca CASP1 provides several research opportunities for understanding conifer root development:

  • Protein interaction studies: Using recombinant CASP1 as bait in pull-down assays or yeast two-hybrid screens to identify conifer-specific interaction partners involved in Casparian strip formation.

  • Comparative analysis: Examining the functional differences between angiosperm and gymnosperm CASP proteins through domain-swapping experiments with recombinant proteins.

  • Tissue-specific barriers: Investigating whether the unique root architecture of conifers results in specialized adaptations of the Casparian strip through immunolocalization studies using antibodies against recombinant CASP1.

  • Molecular tools development: Generating fluorescently tagged recombinant CASP1 for live imaging of Casparian strip formation in conifer roots.

These approaches would build upon established methodologies used in model plants while addressing the unique aspects of conifer root biology.

What methodological approaches can be used to study the response of Picea glauca CASP1 to environmental stresses?

To investigate how environmental stresses affect CASP1 expression and function in Picea glauca:

Experimental Design:

  • Stress treatments: Subject Picea glauca seedlings to controlled drought, salinity, or temperature stresses.

  • Expression analysis: Quantify CASP1 transcript levels using RT-qPCR across stress conditions.

  • Protein localization: Use immunolocalization or fluorescent protein fusions to track changes in CASP1 distribution during stress.

  • Functional analysis: Assess Casparian strip integrity using apoplastic tracers like propidium iodide.

This approach parallels studies in hybrid poplar where changes in transpirational demand were linked to adjustments in root water uptake associated with changes in membrane protein expression . Similar methodologies could reveal how conifers regulate their root barriers under stress conditions.

How can mutation analysis of recombinant Picea glauca CASP1 inform our understanding of Casparian strip formation?

Strategic mutation analysis of recombinant Picea glauca CASP1 can provide valuable insights through:

  • Targeted mutations of conserved residues: Based on findings with Arabidopsis CASP1, mutations in specific conserved residues (like W164G or C168S) can help determine their importance for conifer CASP localization and function .

  • Domain deletion experiments: Creating recombinant variants with deleted extracellular loops can test whether the dispensability of these loops for localization observed in Arabidopsis is conserved in conifers .

  • Heterologous expression systems: Expressing mutated recombinant Picea glauca CASP1 in Arabidopsis casp mutants to assess functional complementation.

This approach would help identify both conserved mechanisms and conifer-specific aspects of Casparian strip formation, particularly given the evolutionary distance between angiosperms and gymnosperms.

How does Picea glauca CASP1 function relate to aquaporin expression and water transport?

Research indicates potential functional relationships between CASP proteins and aquaporins in regulating water transport:

  • Co-localization patterns: In Picea glauca, aquaporin proteins have been immunolocalized in needle cross-sections , suggesting tissue-specific coordination of water transport mechanisms that may involve CASP-mediated barriers.

  • Response to dehydration: Studies in poplars have shown that aquaporin gene expression changes in response to dehydration and rehydration , suggesting a coordinated response system that may also involve CASP-regulated barriers.

  • Potential molecular interactions: The plasma membrane domains established by CASP proteins restrict the diffusion of other membrane proteins , potentially regulating the distribution and function of aquaporins in specific cell layers.

Understanding how Picea glauca CASP1 contributes to these water transport regulation systems would provide valuable insights into conifer drought responses and water use efficiency.

What techniques can be used to study the interaction between Picea glauca CASP1 and lignin deposition machinery?

To investigate the role of CASP1 in coordinating lignin deposition in Picea glauca:

Recommended Techniques:

  • Co-immunoprecipitation: Using antibodies against recombinant CASP1 to identify associated proteins in native root tissues.

  • Proximity labeling: Employing BioID or APEX2 fusions with recombinant CASP1 to identify proximal proteins in the lignification machinery.

  • Histochemical analysis: Using lignin-specific stains like safranin (as mentioned in the PhD dissertation ) to visualize Casparian strip formation in relation to CASP1 expression.

  • In vitro reconstitution: Combining purified recombinant CASP1 with potential interaction partners and lignin precursors to assess the ability to generate lignin-like polymers in a controlled system.

These approaches could reveal whether the mechanism by which CASPs mediate lignin deposition in the Casparian strip of angiosperms (through interaction with peroxidases ) is conserved in Picea glauca or if conifers have evolved distinct lignification mechanisms.

What are the main technical challenges in studying recombinant Picea glauca CASP1 and how can they be overcome?

Current Challenges and Solutions:

ChallengeSolution Approach
Limited genomic information for Picea glaucaUse transcriptome data and homology-based approaches to identify and clone full-length CASP1
Membrane protein expression difficultiesTest multiple expression systems; optimize using fusion partners that enhance membrane insertion
Conifer transformation challengesDevelop transient expression systems; utilize heterologous systems with complementation assays
Visualizing CASP-specific structuresCombine immunolocalization with electron microscopy; develop specific dyes for Casparian strip visualization
Slow growth of conifer experimental systemsEstablish cell culture systems expressing recombinant CASP1 for more rapid experiments

What are promising future research directions for Picea glauca CASP1 studies?

  • Comparative genomics: Expanding the analysis of CASP proteins across more conifer species to identify gymnosperm-specific adaptations in root barrier formation.

  • Climate change adaptation: Investigating how CASP1-mediated barrier properties respond to changing climate conditions, particularly in the context of altered water availability.

  • Root symbioses: Exploring the role of CASP proteins in regulating mycorrhizal associations, which are particularly important for conifer nutrition.

  • Developmental regulation: Characterizing the transcriptional networks that control CASP1 expression in conifers, potentially involving MYB transcription factors similar to the MYB36 that regulates CASP expression in Arabidopsis .

  • Biotechnology applications: Exploring whether modified CASP proteins could be used to engineer improved drought tolerance or nutrient use efficiency in commercially important conifer species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.