Recombinant Picea sitchensis CASP-like protein 4

Shipped with Ice Packs
In Stock

Description

Biosynthesis and Recombinant Production

Recombinant CASPL proteins are typically expressed in E. coli systems with affinity tags (e.g., N-terminal His-tag) for purification . For example:

ParameterSpecificationSource
Host SystemE. coli
TagHis-tag (N-terminal)
Protein LengthFull-length (1–205 aa)
FormLyophilized powder

Picea sitchensis CASP-like protein 4 likely follows similar production protocols, though explicit data remains unreported.

Role in Casparian Strip Formation

  • Arabidopsis CASPs (e.g., CASP1–5) scaffold lignin-polymerizing enzymes (RBOHF, PER64, ESB1) at endodermal plasma membranes, ensuring localized lignin deposition .

  • ZmCASPLs in maize show 72% containing CASP domains, while others feature MARVEL domains linked to membrane organization .

Stress Response Regulation

  • AtCASPL4C1 (Arabidopsis homolog) negatively regulates cold tolerance; knockouts exhibit accelerated growth and enhanced stress resilience .

  • ClCASPL in watermelon alters ROS dynamics under cold stress, suggesting conserved roles in abiotic signaling .

Evolutionary Context

CASPLs are ubiquitous in land plants and green algae, with gene duplication and intron insertion driving functional diversification . Phylogenetic analysis groups CASPLs into six subgroups, with Group VI being the largest (10 ZmCASPLs, 15 AtCASPLs) .

Conservation Across Species:

SpeciesCASPL CountKey Features
Arabidopsis thaliana39Redundant roles in CS formation
Oryza sativa41High root-specific expression
Picea sitchensisUndefinedPredicted MARVEL domain homology

Research Gaps and Future Directions

  • Functional Characterization: No direct studies on Picea sitchensis CASP-like protein 4 exist. Homology modeling and knockout studies are needed to elucidate its role in conifer stress responses.

  • Domain Interactions: The significance of its EL1 domain (if conserved) in membrane scaffolding remains untested.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will then prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CASP-like protein 2BC1; PsCASPL2BC1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Picea sitchensis (Sitka spruce) (Pinus sitchensis)
Target Protein Sequence
MRKHIDIVFSRLSGPILNPPPDNNVIPKTDRKLRITEVILRFAVVIFALVSAIMVGTASG TRDLGGGIRIHAHFTLLKTLPFLVIVDGILAVYSLLQGLRCFLSLYMRHILLNKALAWTI FCCDQALAYVIFAAAASTAETAYISEQGLDELQWIKVCMFFRAYCFKSGAGMINAFLAAL CMVFVSGMSVFHLFRLYGEKRAYGHIAEQVVISEEAAERRNSLNGI
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Picea sitchensis CASP-like protein 4 and what is its role in plant biology?

Picea sitchensis CASP-like protein 4 (PsCASPL4) is a member of the CASP-like protein family found in Sitka spruce. The full-length protein consists of 226 amino acids and belongs to a larger family of membrane proteins involved in forming specialized membrane domains . CASP-like proteins share structural and functional similarities with Casparian Strip Membrane Domain Proteins (CASPs), which are four-membrane-span proteins that mediate the deposition of Casparian strips in the endodermis by recruiting lignin polymerization machinery . While specific functions of PsCASPL4 are still being investigated, CASP-like proteins generally participate in the formation of membrane scaffolds and potentially contribute to cell wall modifications, similar to how CASPs function in organizing plasma membrane domains for Casparian strip formation .

How are CASP and CASP-like proteins structurally characterized?

CASP and CASP-like proteins generally share a conserved structural organization consisting of four predicted transmembrane domains with cytoplasmic N and C termini. The N-terminus length is variable across different proteins in this family, while the C-terminus and intracellular loop tend to be short . A distinct feature of these proteins is the high conservation in the transmembrane domains, particularly the first (TM1) and third (TM3) domains. Most CASP-like proteins contain a characteristic arginine residue in TM1 and an aspartic acid residue in TM3 . These conserved charged amino acids likely play critical roles in protein-protein interactions within the membrane, contributing to the formation of stable membrane domains with scaffold-like properties.

What is the evolutionary relationship between CASP-like proteins and MARVEL proteins?

The CASP-like protein family shares significant evolutionary connections with the MARVEL (MAL and related proteins for vesicle trafficking and membrane link) protein family. Sequence analysis has revealed that CASPLs are annotated in UniProtKB as carrying a MARVEL-like domain (IPR021128) . Proteins from both families show high similarity in their transmembrane domains, particularly in the conservation pattern of basic (Arg, His, and Lys) and acidic (Asp and Glu) amino acids in TM1 and TM3 . Computational analyses have shown that CASPLs and MARVELs can be predicted with high probability to be members of both families, indicating their likely homologous relationship .

An interesting evolutionary aspect is the almost complementary taxonomic distribution of species with predicted CASPL (DUF588 and PF04535) or MARVEL (PF01284) domains in opisthokonts and plants . This pattern suggests ancient divergence from a common ancestor, with subsequent specialization of MARVEL proteins in animals and fungi, and CASPL proteins in the plant kingdom.

What experimental methods are most effective for studying CASP-like protein localization?

For studying CASP-like protein localization, several complementary approaches have proven effective:

  • Fluorescent protein fusion techniques: Creating fusion proteins with fluorescent tags (GFP, mCherry) allows for in vivo tracking of protein localization. This approach has been successfully used to demonstrate that CASPs initially target the whole plasma membrane before becoming restricted to specific membrane domains .

  • Confocal microscopy with time-lapse imaging: This technique enables visualization of dynamic processes such as the evolution of protein localization patterns over time. Studies have shown that wild-type CASP1 fused to mCherry starts localizing at the Casparian Strip Membrane Domain at specific time points, with different mutations affecting this timing .

  • Immunolocalization with transmission electron microscopy: For higher resolution studies, immunogold labeling combined with electron microscopy can precisely locate proteins within membrane subdomains.

  • Membrane fractionation followed by protein detection: Biochemical approaches involving membrane isolation and subsequent Western blotting can complement imaging data by confirming protein presence in specific membrane fractions.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique has been used to demonstrate the low turnover rate of CASPs in their membrane domains, providing insights into the stability of protein scaffolds .

How can mutations in conserved residues of CASP-like protein 4 affect its localization and function?

Mutational studies of conserved residues in CASP proteins have revealed critical insights that may be applicable to CASP-like protein 4:

  • Transmembrane domain mutations: Alterations of conserved amino acids in transmembrane domains, particularly the conserved Arg in TM1 and Asp in TM3, likely affect membrane integration and scaffold formation .

  • Extracellular loop mutations: Research on CASP1 has shown that mutations in residues shared among most CASPLs in the extracellular loop 2 (EL2) affect localization to varying degrees. For instance, mutations like C168S, F174V, and C175S result in prolonged persistence at the lateral plasma membrane, while G158S shows delayed localization at the Casparian Strip Membrane Domain .

  • Critical residue effects: Some mutations have dramatic effects on localization. The W164G mutation in CASP1 showed the strongest effect, with the protein being initially excluded from the CSD and almost undetectable later .

  • Functional impact assessment: The functional consequences of these mutations can be assessed through complementation studies in knockout lines, analyzing the integrity of resulting membrane domains, or examining effects on cell wall modification processes.

This mutational approach can be applied systematically to PsCASPL4 to identify critical residues for its subcellular targeting and function, potentially revealing unique features that distinguish it from other CASP-like proteins.

How can recombinant Picea sitchensis CASP-like protein 4 be utilized in protein-protein interaction studies?

Recombinant Picea sitchensis CASP-like protein 4 provides a valuable tool for investigating protein-protein interactions through multiple experimental approaches:

  • Pull-down assays: The His-tagged recombinant PsCASPL4 (available as a full-length protein) can be immobilized on nickel-affinity resin and used to capture interacting proteins from plant extracts. This approach helps identify stable interaction partners from complex biological samples.

  • Co-immunoprecipitation validation: Interactions identified in pull-down assays can be validated through co-immunoprecipitation experiments in native conditions, using antibodies against PsCASPL4 or potential interaction partners.

  • Yeast two-hybrid screening: The coding sequence of PsCASPL4 can be used in yeast two-hybrid screens to identify direct protein-protein interactions . This approach has been successfully employed to detect interactions involving CASP-like proteins.

  • Bimolecular Fluorescence Complementation (BiFC): By fusing PsCASPL4 and candidate interactors to complementary fragments of a fluorescent protein, interactions can be visualized directly in plant cells, providing spatial information about where these interactions occur.

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC): These biophysical techniques can be used with the purified recombinant protein to quantitatively characterize binding affinities and thermodynamic parameters of interactions with other purified proteins.

The methodical application of these complementary approaches can help construct an interaction network centered on PsCASPL4, potentially revealing its role in membrane domain organization and cell wall modification pathways.

What approaches can be used to investigate the role of CASP-like protein 4 in cell wall modification?

Investigating the role of PsCASPL4 in cell wall modification requires a multifaceted approach:

  • Histochemical analysis: Various staining techniques (phloroglucinol for lignin, calcofluor white for cellulose) can be used to analyze cell wall composition in tissues expressing normal versus altered levels of PsCASPL4.

  • Immunolocalization studies: Using antibodies against PsCASPL4 alongside markers for cell wall components can reveal spatial correlations between protein localization and specific cell wall modifications.

  • Transgenic approaches: Creating transgenic lines with altered PsCASPL4 expression (overexpression, RNAi knockdown, or CRISPR/Cas9 knockout) can provide insights into its functional significance in cell wall development.

  • Cell wall composition analysis: Techniques such as Fourier Transform Infrared (FTIR) spectroscopy, pyrolysis-GC/MS, or comprehensive microarray polymer profiling can be used to detect changes in cell wall composition resulting from altered PsCASPL4 activity.

  • Enzyme activity assays: Since CASPs are involved in recruiting lignin polymerization machinery , assays measuring the activity of enzymes involved in lignin biosynthesis (such as peroxidases or laccases) in the presence of PsCASPL4 can provide functional insights.

  • Live cell imaging: Using fluorescently tagged PsCASPL4 together with cell wall dyes can allow real-time observation of its role during cell wall deposition and modification events.

These approaches can collectively elucidate whether PsCASPL4 functions similarly to characterized CASPs in Casparian strip formation or has evolved specialized functions in gymnosperm cell wall biology.

How does CASP-like protein 4 compare to other CASP-like proteins in Picea sitchensis?

Comparison between Picea sitchensis CASP-like proteins reveals important structural and potentially functional differences:

  • Protein length differences: PsCASPL4 consists of 226 amino acids , while PsCASPL1 is significantly shorter at 157 amino acids . This difference in length may reflect variations in functional domains, particularly in the variable N-terminal region or extracellular loops.

  • Sequence conservation patterns: While specific comparison data between PsCASPL proteins is limited in the provided sources, CASP-like proteins generally share high conservation in transmembrane domains while showing variability in extracellular loops and terminal regions .

  • Expression patterns: Different CASP-like proteins may show tissue-specific or developmentally regulated expression patterns, suggesting specialized functions in different plant tissues or developmental stages. A systematic transcriptomic analysis would help elucidate these differences among Picea sitchensis CASP-like proteins.

  • Functional specialization: Based on studies of CASP proteins in Arabidopsis, which show functional diversification (CASP1 to CASP5) , it's reasonable to hypothesize that different PsCASPL proteins may have evolved specialized functions in gymnosperm biology.

  • Evolutionary relationships: Phylogenetic analysis of the complete set of CASP-like proteins in Picea sitchensis would reveal their evolutionary relationships and provide insights into potential functional divergence or redundancy.

Comprehensive comparative analysis of the entire CASP-like protein family in Picea sitchensis would significantly advance our understanding of their specialized roles in gymnosperm cell biology.

What is known about the evolutionary adaptation of CASP-like proteins in gymnosperms compared to angiosperms?

The evolutionary adaptation of CASP-like proteins in gymnosperms like Picea sitchensis compared to angiosperms reflects the distinct developmental and physiological needs of these plant lineages:

  • Conservation across plant divisions: CASP-like proteins have been identified in all major divisions of land plants , indicating their fundamental importance in plant biology. Their presence in both gymnosperms and angiosperms suggests ancient origins predating the divergence of these groups.

  • Casparian strip evolution: The Casparian strip, a specialized cell wall modification mediated by CASP proteins, is present in various plant lineages but may show structural and compositional differences between gymnosperms and angiosperms. These differences may be reflected in the specialized functions of their respective CASP-like proteins.

  • Adaptation to environmental pressures: Gymnosperms like Picea sitchensis often inhabit challenging environments and may have evolved specialized functions for their CASP-like proteins to address specific stresses. For example, cold tolerance or drought resistance mechanisms might involve modified cell wall structures mediated by CASP-like proteins.

  • Functional domain adaptations: The specific sequence variations in functional domains of gymnosperm CASP-like proteins may reflect adaptations to unique aspects of gymnosperm cell biology, particularly relating to their distinctive vascular architecture and cell wall composition.

  • Gene family expansion patterns: The number and diversity of CASP-like genes may differ between gymnosperms and angiosperms due to different patterns of gene duplication and functional diversification throughout their evolutionary history.

Comparative genomic and functional studies across plant lineages would provide deeper insights into how CASP-like proteins have evolved to serve specialized functions in gymnosperm biology.

What emerging technologies show promise for elucidating CASP-like protein functions?

Several cutting-edge technologies show significant promise for advancing our understanding of CASP-like protein functions:

  • Cryo-electron microscopy: This technique could reveal the detailed three-dimensional structure of CASP-like proteins within their native membrane environment, providing insights into how they form scaffolds and interact with other proteins.

  • Single-molecule tracking: Advanced microscopy techniques allowing tracking of individual protein molecules in living cells could reveal dynamic aspects of CASP-like protein behavior, including their movement, clustering, and interactions with other membrane components.

  • Proximity labeling approaches: Techniques like BioID or APEX2 proximity labeling could identify proteins that transiently interact with or exist in close proximity to CASP-like proteins, helping define their functional neighborhoods within the cell.

  • Nanodomain proteomics: Advances in membrane proteomics allowing analysis of specific membrane nanodomains could help characterize the protein composition of CASP-like scaffold domains.

  • Long-read sequencing: For species like Picea sitchensis with complex genomes, long-read sequencing technologies can improve genome assemblies and gene annotations, potentially revealing additional CASP-like protein variants.

  • Single-cell transcriptomics: This approach could reveal cell-type specific expression patterns of CASP-like proteins in complex tissues, helping to associate specific CASP-like proteins with specialized cell types and functions.

  • CRISPR-Cas9 base editing and prime editing: These precision genome editing techniques allow subtle modifications to specific residues in CASP-like proteins, enabling detailed structure-function studies without completely disrupting the protein.

Integration of these emerging technologies promises to significantly advance our understanding of how CASP-like proteins function in organizing membrane domains and mediating cell wall modifications.

How might CASP-like proteins be involved in gymnosperm stress responses?

The potential involvement of CASP-like proteins in gymnosperm stress responses represents an intriguing area for future research:

  • Cell wall reinforcement: CASP-like proteins may coordinate stress-induced cell wall modifications, similar to how CASPs mediate Casparian strip formation . Under stress conditions, these proteins could help reinforce cell walls to protect against mechanical stress or pathogen invasion.

  • Regulation of membrane permeability: By forming membrane scaffolds, CASP-like proteins might regulate the permeability of cell membranes during stress conditions, controlling the movement of water, ions, or signaling molecules between cells or tissue compartments.

  • Temperature stress adaptation: Gymnosperms like Picea sitchensis often face temperature extremes. CASP-like proteins might play roles in cold hardiness or heat stress responses by modifying membrane properties or cell wall characteristics to maintain cellular integrity.

  • Drought response mechanisms: CASP-like proteins could be involved in coordinating changes to water transport pathways in vascular tissues during drought stress, potentially through modifications to cell walls or organization of transport proteins in specialized membrane domains.

  • Pathogen defense responses: Upon pathogen attack, CASP-like proteins might help organize membrane domains involved in defense signaling or contribute to the formation of physical barriers (such as callose deposits or lignification) to limit pathogen spread.

  • Signaling platform organization: CASP-like proteins could organize membrane domains that serve as platforms for stress signaling complexes, bringing together receptors and downstream signaling components to facilitate rapid and efficient stress responses.

Research combining transcriptomic analyses under various stress conditions with functional studies of specific CASP-like proteins would help elucidate their roles in gymnosperm stress adaptation mechanisms.

What are the challenges in expressing and purifying functional CASP-like membrane proteins?

Working with recombinant CASP-like proteins presents several technical challenges due to their membrane-spanning nature:

  • Membrane protein solubility: As four-transmembrane proteins , CASP-like proteins are highly hydrophobic and prone to aggregation when expressed in heterologous systems. This necessitates careful optimization of expression conditions and solubilization methods.

  • Maintaining native conformation: Preserving the native conformation of CASP-like proteins during purification requires selection of appropriate detergents or lipid environments that mimic the native membrane context without disrupting protein structure.

  • Expression system selection: While E. coli is commonly used for CASP-like protein expression , eukaryotic expression systems may better support proper folding and post-translational modifications. Comparing protein functionality from different expression systems may be necessary.

  • Purification strategy optimization: The His-tagged versions of PsCASPL proteins allow for nickel-affinity purification, but additional purification steps may be needed to achieve high purity without compromising protein activity.

  • Functionality assessment: Unlike enzymatic proteins, membrane scaffold proteins like CASPLs lack easily measurable activities. Alternative approaches to assess functionality, such as liposome reconstitution assays or membrane interaction studies, need to be developed.

  • Protein stability during storage: Maintaining stability of purified CASP-like proteins during storage requires optimization of buffer conditions, potentially including specific lipids or detergents to prevent aggregation or denaturation.

  • Reconstitution for functional studies: For functional studies, purified CASP-like proteins often need to be reconstituted into membrane mimetics such as liposomes, nanodiscs, or supported lipid bilayers, each requiring specific optimization.

Addressing these challenges requires systematic optimization and potentially the development of specialized protocols tailored to the unique properties of CASP-like proteins.

What analytical techniques are most informative for characterizing recombinant CASP-like protein quality and functionality?

Several analytical techniques provide valuable information about the quality and functionality of recombinant CASP-like proteins:

Combining multiple analytical approaches provides complementary information about protein quality and functionality, essential for interpreting subsequent experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.