Recombinant Picea sitchensis CASP-like protein 5

What is Picea sitchensis CASP-like protein 5?

Picea sitchensis CASP-like protein 5 is a transmembrane protein belonging to the CASP-like (Casparian Strip Membrane Domain Protein-like) family found in Sitka spruce (Picea sitchensis). The protein consists of 201 amino acids and likely plays a role in cell wall formation and membrane organization similar to other CASP-like proteins identified in plants. The full amino acid sequence is: MESRTKLDYSETARSYTENKSGGNDAQRINGVYSSSFFVVDFSLRLLVIGSTFTAAIVMGTNKQTAILPIVGPLSAKYQYSPAFVFFVIANAVACGYTLLSLIFSITGKFTSTPLSVFLLSVTDLVMVALVSAGVSAAAAIAYVGYKGNSHTQWGKVCGIYDRFCHHGAGAIVASFVSLIIFMVLTVMSTYSFYRRTSSAR .

How does Picea sitchensis CASP-like protein 5 relate to other CASP proteins?

Picea sitchensis CASP-like protein 5 is part of the larger CASP-like protein family that evolved from the original CASP proteins. While true CASP proteins like those in Arabidopsis (CASP1-CASP5) are specifically involved in Casparian strip formation in the root endodermis, CASP-like proteins have diversified in function and expression patterns. Based on evolutionary analyses of CASP and CASP-like proteins in other plants, Picea sitchensis CASP-like protein 5 likely shares the characteristic four transmembrane domain structure but may have specialized functions in conifers compared to angiosperms .

What are the structural characteristics of CASP-like proteins?

CASP-like proteins, including Picea sitchensis CASP-like protein 5, typically contain four transmembrane domains, which is a hallmark feature of this protein family. The protein sequence analysis indicates a membrane-associated role similar to other CASP proteins. In Arabidopsis, CASP proteins are specifically localized to the Casparian strip within the root endodermis, forming a scaffold for subsequent lignification . The membrane topology of CASP-like proteins allows them to serve as platforms for recruiting other proteins involved in cell wall modifications, though the specific interacting partners of Picea sitchensis CASP-like protein 5 have not been fully characterized .

What expression systems are recommended for producing recombinant Picea sitchensis CASP-like protein 5?

The currently available recombinant Picea sitchensis CASP-like protein 5 is produced in E. coli expression systems with a His-tag for purification purposes . For researchers seeking to express this protein, bacterial expression is advantageous for obtaining large quantities, though careful optimization of induction conditions is necessary due to the membrane-associated nature of this protein. Alternative expression systems worth considering include:

• Yeast systems (Pichia pastoris) for potentially better folding of membrane proteins

• Insect cell systems for complex post-translational modifications

• Plant-based expression systems for native-like processing

When expressing transmembrane proteins like CASP-like protein 5, solubilization strategies using detergents or amphipols may be necessary to maintain proper folding and function.

What purification methods are most effective for Picea sitchensis CASP-like protein 5?

Purification of recombinant Picea sitchensis CASP-like protein 5 typically involves immobilized metal affinity chromatography (IMAC) targeting the His-tag. For researchers working with this protein, a recommended purification workflow includes:

• Cell lysis under native or denaturing conditions (depending on protein solubility)

• IMAC purification using Ni-NTA or Co-based resins

• Size exclusion chromatography to enhance purity

• Optional ion-exchange chromatography for removing remaining contaminants

When working with membrane proteins like CASP-like protein 5, inclusion of appropriate detergents throughout the purification process is critical to maintain protein stability and prevent aggregation. Common detergents include n-dodecyl-β-D-maltoside (DDM) or CHAPS, with concentrations optimized to maintain protein folding while minimizing interference with downstream applications .

How do CASP-like proteins from conifers like Picea sitchensis differ functionally from those in angiosperms?

While angiosperms like Arabidopsis and rice have well-characterized CASP proteins involved in Casparian strip formation in root endodermis, the functional roles of CASP-like proteins in conifers remain less understood. In Arabidopsis, at least twelve AtCASPLs can reach the plasma membrane under the AtCASP1 promoter, with nine specifically locating to the Casparian strip domain (CSD) . The evolutionary distance between conifers and angiosperms suggests that Picea sitchensis CASP-like protein 5 may have evolved divergent functions.

Methodologically, researchers investigating functional differences should consider:

• Comparative transcriptomic analysis across tissue types in Picea sitchensis

• Heterologous expression studies in Arabidopsis to assess localization patterns

• Co-immunoprecipitation experiments to identify interacting partners

• Development of gymnosperm-specific genetic tools for functional characterization in conifers

Current evidence from other plant systems indicates that while the core biochemical functions of membrane organization may be conserved, the tissue-specific expression patterns and downstream effects vary considerably between angiosperms and gymnosperms .

What is known about tissue-specific expression patterns of Picea sitchensis CASP-like protein 5?

For researchers investigating expression patterns, recommended methodological approaches include:

• RT-qPCR analysis across various tissues and developmental stages

• In situ hybridization to localize mRNA in tissue sections

• Promoter-reporter fusion studies if transformation systems are available

• Immunolocalization using antibodies against the native protein or an epitope tag

Understanding tissue-specific expression will provide crucial insights into the biological roles of this protein in conifer development and stress responses .

How can protein-protein interaction studies with Picea sitchensis CASP-like protein 5 be optimized?

Investigating the interactome of Picea sitchensis CASP-like protein 5 presents unique challenges due to its membrane-associated nature. Based on studies of related CASP proteins, potential interacting partners might include enzymes involved in cell wall modification, membrane-associated signaling proteins, or cytoskeletal components.

Recommended methodological approaches include:

• Split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins

• Co-immunoprecipitation followed by mass spectrometry analysis

• Proximity labeling approaches using BioID or APEX2 fusions

• Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) for in vivo interaction studies

When conducting these studies, it's important to consider the membrane environment by:

• Using appropriate detergents that maintain native interactions

• Implementing crosslinking strategies to capture transient interactions

• Considering the orientation of the protein within the membrane

• Including appropriate controls for non-specific binding to hydrophobic regions

In rice, OsCASP1 forms complexes with itself and OsCASP2, which may provide insights into potential oligomerization of Picea sitchensis CASP-like protein 5 .

What approaches can be used to determine the role of Picea sitchensis CASP-like protein 5 in conifer development?

Determining the developmental role of Picea sitchensis CASP-like protein 5 requires a multi-faceted approach, particularly given the challenges of genetic manipulation in conifers. Based on findings from Arabidopsis and rice CASP proteins, potential methods include:

• Transcriptional profiling across developmental stages and in response to environmental stresses

• Heterologous expression in model plants followed by phenotypic analysis

• Development of RNAi or CRISPR-based approaches adapted for conifer transformation

• Biochemical characterization of its interactions with cell wall components

In Arabidopsis, knockouts of certain CASP-like proteins have revealed phenotypes related to flowering time and stress responses. For example, AtCASPL4C1 knockout plants show earlier flowering compared to wild type, suggesting roles beyond cell wall formation .

What structural analyses can provide insights into Picea sitchensis CASP-like protein 5 function?

Structural characterization of membrane proteins like Picea sitchensis CASP-like protein 5 presents significant challenges but can provide valuable insights into function. Recommended approaches include:

• Homology modeling based on related proteins with known structures

• Circular dichroism spectroscopy to assess secondary structure composition

• Limited proteolysis combined with mass spectrometry to identify exposed regions

• Cryo-electron microscopy for higher-resolution structural determination

The four transmembrane domains characteristic of CASP family proteins suggest a scaffold-like function, potentially creating a platform for protein-protein interactions at specific membrane domains. Structural analysis could reveal potential binding sites for interaction partners or substrates .

How do CASP-like proteins in Picea sitchensis compare to those in other plant species?

Comparative analysis of CASP-like proteins across plant species reveals interesting evolutionary patterns. In maize, 47 ZmCASPL members have been identified and classified into six distinct groups, with varying numbers in each group . Similarly, Arabidopsis contains multiple CASP-like proteins with diverse functions.

For researchers interested in evolutionary comparisons, the following approaches are recommended:

• Phylogenetic analysis of CASP and CASP-like proteins across plant lineages

• Synteny analysis to identify conserved genomic regions

• Comparison of protein motifs and domains across species

• Analysis of selection pressures on different protein regions

The evolutionary relationships between Picea sitchensis CASP-like protein 5 and other plant CASP-like proteins may provide insights into functional conservation and diversification across plant lineages spanning gymnosperms and angiosperms .

What are the challenges in working with recombinant membrane proteins like Picea sitchensis CASP-like protein 5?

Working with recombinant membrane proteins presents several technical challenges that researchers should anticipate:

• Expression challenges:

  • Potential toxicity to expression hosts

  • Proper membrane insertion and folding

  • Formation of inclusion bodies

• Purification challenges:

  • Selection of appropriate detergents for solubilization

  • Maintaining protein stability during purification

  • Preventing aggregation

• Functional analysis challenges:

  • Reconstituting proper membrane environment

  • Assessing correct folding and orientation

  • Identifying appropriate functional assays

To address these challenges, researchers should consider:

• Optimizing expression conditions (temperature, induction time, host strain)

• Using fusion partners that enhance solubility

• Implementing quality control steps to assess protein homogeneity and folding

• Considering membrane mimetics like nanodiscs or liposomes for functional studies

What analytical methods are most informative for characterizing purified Picea sitchensis CASP-like protein 5?

Comprehensive characterization of purified Picea sitchensis CASP-like protein 5 requires multiple analytical approaches:

• Purity assessment:

  • SDS-PAGE with Coomassie or silver staining

  • Western blotting using anti-His antibodies

  • Size exclusion chromatography

• Structural integrity:

  • Circular dichroism spectroscopy for secondary structure

  • Fluorescence spectroscopy for tertiary structure assessment

  • Limited proteolysis to assess folding

• Functional characterization:

  • Lipid binding assays

  • Reconstitution into artificial membranes

  • Interaction studies with potential partners

• Biophysical properties:

  • Thermal stability assays

  • Dynamic light scattering for aggregation assessment

  • Analytical ultracentrifugation for oligomeric state determination

These methods provide complementary information about protein quality and properties, essential for meaningful functional studies .