Recombinant Picea sitchensis Cytochrome P450 716B1 (CYP716B1)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome P450 716B1 (CYP716B1) is a member of the cytochrome P450 superfamily, which are monooxygenase enzymes that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids, and other lipids . In Picea sitchensis (Sitka spruce), CYP716B1 plays a role in the biosynthesis of secondary metabolites. Recombinant CYP716B1 refers to the protein produced using recombinant DNA technology, where the gene encoding CYP716B1 from Picea sitchensis is expressed in a host organism to produce large quantities of the protein for research and industrial applications .

Importance of Understanding CYP716B1

Understanding the function and characteristics of CYP716B1 is significant for several reasons:

  • Metabolic Pathways: Elucidating the specific reactions catalyzed by CYP716B1 in Picea sitchensis can provide insights into the plant's metabolic pathways and how it produces specialized metabolites.

  • Biotechnology: Recombinant CYP716B1 can be utilized in biotechnological applications, such as the production of valuable compounds through biocatalysis.

  • Drug Discovery: Cytochrome P450 enzymes are important in drug metabolism, and studying CYP716B1 may offer insights into novel drug interactions or the development of new drugs.

Research Findings

CategoryDescription
Protein NameCytochrome P450 716B1 (CYP716B1)
Source OrganismPicea sitchensis (Sitka spruce)
Production MethodRecombinant DNA technology
FunctionInvolved in the biosynthesis of secondary metabolites
ApplicationsBiocatalysis, metabolic pathway analysis, drug metabolism studies
UniProt Accession NumberQ50EK1
StabilityStable at 4°C for up to one week

Methods for Studying CYP716B1

Several methods can be employed to study recombinant CYP716B1:

  1. Enzyme Assays: These assays measure the activity of CYP716B1 by quantifying the amount of product formed from a specific substrate.

  2. Spectroscopy: Spectroscopic techniques, such as UV-Vis spectroscopy, can be used to study the interaction of CYP716B1 with various ligands and substrates.

  3. Mass Spectrometry: Mass spectrometry can identify and quantify the metabolites produced by CYP716B1, providing insights into its catalytic function.

  4. X-ray Crystallography: Determining the crystal structure of CYP716B1 can reveal details about its active site and substrate-binding mechanism.

Applications of Recombinant CYP716B1

  1. Biocatalysis: Recombinant CYP716B1 can be used as a biocatalyst for the production of valuable compounds, such as pharmaceutical intermediates or flavorings.

  2. Metabolic Engineering: Understanding the role of CYP716B1 in plant metabolism can aid in engineering metabolic pathways to produce desired metabolites in heterologous hosts.

  3. Drug Discovery: Studying the interactions of CYP716B1 with drug candidates can help predict potential drug-drug interactions and improve drug design.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
CYP716B1; Cytochrome P450 716B1; Cytochrome P450 CYPA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-493
Protein Length
full length protein
Species
Picea sitchensis (Sitka spruce) (Pinus sitchensis)
Target Names
CYP716B1
Target Protein Sequence
MVWKEAVSVLQKAQELKEPPLMFTVFLASFIGLAFFFYLISNHRTKAWRGIPPGTFGWPL IGETLEFLGCQRKGNPRDFFDSRTQKYGNVFTTSLVGHPTVVFCSPEGNRFLFSNENKLV VNSWPSSVGNLFRSSLITTVGDDAKRLRRILMTFLRPEALREFVGRVDSMTKRHLAEHWI GKDEVMALPLLKRYTFSLACDLFASINTKDDLDRLWLHFMVFVKGVMQIPIDLPGTRYNK TKHAANAIRQQLGSIINERKIALEAGNASPEQDLLSFLLSNVDEQGESLTDNEIQDNILL LLYAGHDTSSSTLTVLLKFLAENPHCYEEVLREQLNIAGSKEEGQLLEWEDLQRMKYSWR VAQEALRLFPAVQGSFRKAIKEFIYDGFTIPKGWKLHWTVNSTHQKSEYFSNPEKFDPSR FEGEGPPPYTFVPFGGGPRMCPGNEFARMEILIFLHNIVKNFNWNLVNPLEKVIVDPMPA PVNGLPIKLVPHD
Uniprot No.

Target Background

Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CYP716B1 and what organism does it originate from?

CYP716B1 (Cytochrome P450 716B1) is a member of the cytochrome P450 enzyme family that originates from Picea sitchensis, commonly known as Sitka spruce or Pinus sitchensis. This enzyme belongs to the CYP716 subfamily of cytochrome P450 proteins, which are heme-containing enzymes involved in various metabolic processes. The official recommended name for this protein is Cytochrome P450 716B1, with EC number 1.14.-.- indicating its oxidoreductase activity. It has also been referred to by the alternative name Cytochrome P450 CYPA1. CYP716B1 is a transmembrane protein, suggesting its association with cellular membranes, which is characteristic of many cytochrome P450 enzymes involved in specialized metabolism in plants.

How is recombinant CYP716B1 typically produced for research purposes?

Recombinant CYP716B1 is typically produced using in vitro E. coli expression systems. The production process generally involves cloning the full-length coding sequence (corresponding to amino acids 1-493) into a suitable expression vector that incorporates an N-terminal His-tag for purification purposes. The His-tag fusion, typically a 10xHis-tag, facilitates protein purification through metal affinity chromatography. The protein is expressed in E. coli under optimized conditions that may include adjustments to temperature, induction parameters, and media composition to ensure proper folding and maximum yield of the functional protein. Following expression, the protein is purified from bacterial lysates and can be provided in either liquid form or as a lyophilized powder, depending on the research requirements and stability considerations.

What are the optimal storage conditions for recombinant CYP716B1?

For optimal stability and activity maintenance, recombinant CYP716B1 should be stored at -20°C, with extended storage recommended at either -20°C or -80°C. The protein's shelf life varies depending on its formulation: liquid preparations typically maintain stability for approximately 6 months when stored at -20°C/-80°C, while lyophilized forms exhibit greater stability, with a shelf life of approximately 12 months under the same storage conditions. For working solutions, temporary storage at 4°C is acceptable for up to one week, but repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and activity loss. These storage recommendations apply to both His-tagged recombinant forms and are designed to preserve the protein's structural integrity and enzymatic function for research applications.

What is the potential functional role of CYP716B1 in plant systems?

CYP716B1 likely functions as a specialized metabolism enzyme in Picea sitchensis, potentially catalyzing oxidation reactions in secondary metabolite biosynthetic pathways. While the specific substrates and products for CYP716B1 are not explicitly detailed in the available data, related cytochrome P450 enzymes in the CYP716 family from other plant species are known to be involved in terpenoid biosynthesis, particularly in the oxidative modification of triterpenoid backbones. The functional annotation as EC 1.14.-.- indicates monooxygenase activity, suggesting that CYP716B1 catalyzes the incorporation of one oxygen atom from molecular oxygen into its substrate. Research data showing CYP716B1 downregulation in Verticillium-infected black raspberry roots (with a FPKM fold change of -1.55) suggests this enzyme may play a role in plant defense responses, possibly through regulation of defense-related metabolite production or resource allocation during pathogen challenge.

How does CYP716B1 expression change during plant-pathogen interactions?

RNA sequencing data from comparative studies of untreated versus Verticillium-infected black raspberry roots reveals significant downregulation of CYP716B1 during pathogen infection. Specifically, CYP716B1 expression decreased from 61.73 FPKM (Fragments Per Kilobase of target sequence per Million reads mapped) in untreated roots to 21.14 FPKM in Verticillium-infected roots, representing a fold change of -1.55 with a statistically significant p-value of 5.00E-05. This downregulation pattern suggests that CYP716B1 may be involved in metabolic processes that are strategically reduced during pathogen challenge, possibly reflecting a reallocation of resources toward more direct defense responses. It is noteworthy that this expression pattern was observed in black raspberry rather than the native Picea sitchensis, indicating that CYP716B1 homologs or orthologs may have conserved regulatory responses across different plant species during pathogen interactions.

How does CYP716B1 compare with other plant cytochrome P450 enzymes identified in pathogen response studies?

Comparative analysis of expression patterns during pathogen infection reveals that CYP716B1 belongs to a subset of cytochrome P450 enzymes that are differentially regulated in response to pathogens. In the study of Verticillium-infected black raspberry roots, CYP716B1 showed significant downregulation (fold change -1.55), which contrasts with another cytochrome P450, CYP75B1 (Flavonoid 3'-monooxygenase), that exhibited a similar downregulation pattern (fold change -1.69). These differential expression patterns suggest specialized roles for different P450 enzymes during pathogen response. While CYP716B1 is downregulated, other oxidative enzymes show upregulation during infection, such as ANS (Leucoanthocyanidin dioxygenase) with a fold change of 2.28 and Gibberellin 3-beta-dioxygenase with a fold change of 2.29. This contrasting regulation underscores the complex metabolic reprogramming that occurs during plant-pathogen interactions, with certain P450-mediated pathways being suppressed while others are enhanced.

What structural similarities exist between CYP716B1 and CYP716B2 from Picea sitchensis?

CYP716B1 and CYP716B2 from Picea sitchensis represent closely related cytochrome P450 enzymes with significant structural similarities. CYP716B1 consists of 493 amino acids, while CYP716B2 is slightly longer at 497 amino acids. Both proteins can be expressed as recombinant proteins in E. coli with N-terminal His-tags, suggesting similar structural properties that allow for prokaryotic expression. They share the same UniProt classification and are similarly classified as transmembrane proteins. The close numerical designation (B1 vs. B2) indicates they belong to the same subfamily within the CYP716 family and likely arose through gene duplication events, potentially followed by subfunctionalization or neofunctionalization. Comparative sequence analysis between these two proteins would be valuable for identifying conserved catalytic domains and variable regions that might contribute to potential functional diversification or substrate specificity differences.

What expression systems are optimal for producing functional recombinant CYP716B1?

For functional expression of recombinant CYP716B1, E. coli-based expression systems have been successfully employed. The protein's full-length sequence (amino acids 1-493) has been expressed with an N-terminal 10xHis-tag to facilitate purification. When selecting an expression system, researchers should consider that CYP716B1 is a transmembrane protein, which may present challenges for soluble expression in prokaryotic systems. Modifications to standard protocols might include: (1) using specialized E. coli strains optimized for membrane protein expression; (2) employing lower induction temperatures (16-20°C) to slow protein production and improve folding; (3) adding chemical chaperones to the culture medium; and (4) considering the addition of δ-aminolevulinic acid as a heme precursor to improve incorporation of the essential heme cofactor. For more complex studies requiring post-translational modifications, insect cell or yeast expression systems might provide advantages over E. coli, though these alternatives would require optimizing new expression constructs and conditions.

What are the critical considerations for designing CYP716B1 activity assays?

When designing activity assays for CYP716B1, researchers should address several critical factors to ensure reliable results. First, as a cytochrome P450 enzyme, CYP716B1 requires appropriate redox partners (typically NADPH-cytochrome P450 reductase and potentially cytochrome b5) to transfer electrons from NADPH to the P450 active site. These components must be included in reconstituted systems or supplied by microsomes if membrane preparations are used. Second, assay buffer composition is crucial, typically requiring physiological pH (7.0-7.5), appropriate ionic strength, and sometimes lipids or detergents to maintain protein stability and function. Third, substrate selection requires careful consideration, as CYP716B1 likely has specificity for certain terpenoid structures based on its classification. Fourth, activity detection methods must be sensitive to the expected products, which may involve HPLC, LC-MS, or GC-MS analysis depending on substrate and product properties. Finally, proper controls must be included, such as heat-inactivated enzyme, no-substrate controls, and positive controls using P450 enzymes with known activities if available.

How can researchers troubleshoot expression issues with recombinant CYP716B1?

When encountering expression issues with recombinant CYP716B1, researchers can implement a systematic troubleshooting approach. First, codon optimization for the expression host should be verified, as the conifer-derived sequence may contain codons rarely used in E. coli. Second, expression construct design should be evaluated to ensure the His-tag or other fusion partners do not interfere with protein folding; testing both N-terminal and C-terminal tag positions may be informative. Third, expression conditions should be optimized by testing various induction temperatures (typically lowering to 16-20°C), IPTG concentrations (often reducing to 0.1-0.5 mM), and induction times (extending to overnight). Fourth, specialized E. coli strains designed for membrane or difficult-to-express proteins should be considered. Fifth, addition of heme precursors (δ-aminolevulinic acid) or iron supplements may improve incorporation of the essential cofactor. Sixth, solubilization strategies using different detergents (CHAPS, DDM, or Triton X-100) should be tested if the protein is expressed but insoluble. Finally, if E. coli expression continues to be problematic, alternative expression systems such as yeast (P. pastoris or S. cerevisiae) or insect cells might provide better results for this plant-derived membrane protein.

How might CYP716B1 be utilized in metabolic engineering applications?

CYP716B1 presents potential applications in metabolic engineering due to its likely role in specialized metabolism pathways, particularly those involving terpenoid biosynthesis. Researchers could exploit this enzyme in several ways: First, expressing CYP716B1 in heterologous systems alongside other terpenoid biosynthetic genes could create novel production platforms for valuable plant compounds. Second, the enzyme could be employed in combinatorial biosynthesis approaches to generate new-to-nature compounds by exposing diverse substrates to CYP716B1-catalyzed oxidation. Third, protein engineering of CYP716B1 through site-directed mutagenesis or directed evolution could potentially create variants with enhanced catalytic properties or altered substrate specificities. Fourth, as CYP716B1 appears to be regulated during pathogen response, its controlled expression might be harnessed to enhance plant defense capabilities in crop species. Finally, comparative studies between CYP716B1 and related enzymes like CYP716B2 could provide insights into structure-function relationships that inform rational design of improved biocatalysts for pharmaceutical or agricultural applications.

What approaches would be effective for identifying natural substrates of CYP716B1?

To identify the natural substrates of CYP716B1, researchers should consider implementing a multi-faceted approach combining metabolomic analysis with enzyme characterization techniques. First, untargeted metabolomics comparing wild-type Picea sitchensis tissues with those where CYP716B1 is overexpressed or silenced could reveal metabolites that accumulate or diminish, respectively. Second, in vitro screening of candidate substrates based on knowledge of related CYP716 enzymes, which often act on triterpenoids, would provide a focused approach. Third, heterologous expression of CYP716B1 in yeast systems engineered to produce various terpenoid scaffolds could identify compatible substrates through product detection. Fourth, co-expression analysis identifying genes whose expression patterns correlate with CYP716B1 might reveal enzymes operating in the same pathway, providing clues about substrate class. Fifth, phylogenetic analysis comparing CYP716B1 with functionally characterized P450s could predict substrate classes based on evolutionary relationships. Finally, docking studies using homology models of CYP716B1 with potential substrates could predict binding affinities and guide experimental testing.

What role might CYP716B1 play in conifer defense mechanisms against pathogens?

The role of CYP716B1 in conifer defense mechanisms against pathogens appears complex, with evidence suggesting involvement in specialized metabolism regulation during stress responses. RNA sequencing data showing downregulation of CYP716B1 in Verticillium-infected tissues (fold change -1.55) indicates that suppression of this enzyme's activity may be part of the plant's adaptive response to pathogen challenge. This downregulation could represent a strategic reallocation of resources away from certain specialized metabolic pathways toward more direct defense responses. Alternatively, the reduction in CYP716B1 expression might reflect pathogen manipulation of host metabolism. CYP716B1 potentially functions in terpenoid biosynthesis pathways that produce defense compounds like resin acids or specialized triterpenes in conifers. Interestingly, other terpenoid pathway enzymes like ent-copalyl diphosphate synthase and ent-kaurenoic acid oxidase (KAO1) are also downregulated during infection, suggesting coordinated regulation of these pathways. Future research comparing constitutive and induced levels of terpenoid compounds in tissues with varying CYP716B1 expression would help clarify this enzyme's specific role in conifer defense systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.