Recombinant Pichia angusta High osmolarity signaling protein SHO1 (SHO1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant SHO1 is produced via heterologous expression in Pichia angusta, leveraging the yeast’s thermotolerance and high protein secretion capacity . Key steps include:

Expression Protocol

  1. Vector Construction: SHO1 gene (HPODL_3605) cloned into methanol-inducible vectors (e.g., pFPMT or pGAP) .

  2. Fermentation:

    • Growth phase: Glycerol-based media (30°C, pH 6.0).

    • Induction phase: Methanol (0.5–1%) for 48–72 hours .

  3. Purification:

    • Affinity chromatography (Ni-NTA for His-tagged proteins).

    • Final buffer: Tris-based with 50% glycerol; storage at -20°C/-80°C .

Yield and Purity

  • Typical yield: 1–2 mg/L in shake-flask cultures.

  • Purity: >90% (SDS-PAGE verified) .

Functional Insights

SHO1 operates within the HOG pathway, which activates mitogen-activated protein kinase (MAPK) cascades under osmotic stress:

Mechanistic Roles

  • Osmosensing: Detects extracellular osmolarity via transmembrane domains .

  • Signal Transduction: Interacts with MAPKKK Ste11 to activate downstream effectors .

Thermotolerance Link

  • Pichia angusta thrives at 42°C, and recombinant proteins like SHO1 exhibit enhanced stability at elevated temperatures compared to Saccharomyces cerevisiae homologs .

  • Thermostability Data:

    ProteinHalf-life at 37°COptimal Activity Temperature
    SHO1 (P. angusta)>10 hours42–45°C
    SHO1 (S. cerevisiae)<1 hour30–35°C

Applications in Research

  1. Biosensor Development: Used in engineered Hansenula polymorpha strains for detecting environmental stressors (e.g., osmolarity, temperature) .

  2. Protein Interaction Studies: SH3 domain serves as a model for studying MAPK signaling networks .

  3. Biotechnological Platforms: Thermostable SHO1 enhances robustness in industrial yeast strains .

Comparative Analysis with Homologs

FeatureP. angusta SHO1S. cerevisiae SHO1
ThermostabilityHigh (up to 54°C)Low (<37°C)
Expression YieldModerateLow
Industrial ApplicabilityPreferred for thermotoleranceLimited

Future Directions

  • Strain Engineering: Optimizing P. angusta promoters (e.g., MOX, FMD) for higher SHO1 yields .

  • Structural Studies: Cryo-EM analysis of SHO1-MAPK complexes .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we will fulfill any specific format requirements you indicate when placing your order.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
SHO1; HPODL_05363; High osmolarity signaling protein SHO1; Osmosensor SHO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha)
Target Names
SHO1
Target Protein Sequence
MGRSNPVSLFNPFALSTFGFSSIGWIITFAGCIATNTQNNGFPKFAWWAVVFQLLLLIVI VVLYITNTFHYHRFFLTCAIGVAFVYNSNATNNLVYDTSSAPAAASAGFIIQCIVNILWL FYFGSEPSSPIISYIDSFGSSENVMLSSKRSKSNRNAAGQSQIPLDEPYKDETMGYAERN SVSNDNSGLHENPFNTQNYTAQLSGLENASTTNRASALPEDDYPITVRGLFDYDASPDDI NELSFKKGDIFRVKDTVGNWWQGKNSKGEIGMCPSNYLEVIG
Uniprot No.

Target Background

Function
This protein serves as a plasma membrane osmosensor, activating the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pichia angusta and how does it relate to Hansenula polymorpha?

Pichia angusta is a methylotrophic yeast that belongs to the taxonomic complex previously known as Hansenula polymorpha. According to the literature, Pichia angusta strain ATCC 26012/NRRL Y-7560/DL-1 is the same organism as Hansenula polymorpha . This thermotolerant yeast has attracted considerable attention as a promising host for recombinant protein production due to several advantageous characteristics: powerful promoter elements, ability to grow at high density on inexpensive substrates, and unusual recombination systems that promote multiple tandem integration of non-linearized plasmids into the host chromosome .

The taxonomic reclassification from Hansenula polymorpha to Pichia angusta reflects updated phylogenetic understanding, though both names continue to be used somewhat interchangeably in scientific literature. The thermotolerance of this organism is particularly valuable when expressing proteins that benefit from higher temperature conditions, as seen with other proteins like Rad51 that demonstrate optimal activity at elevated temperatures .

What is the High Osmolarity Signaling Protein SHO1 and what is its function?

The High Osmolarity Signaling Protein SHO1 (also referred to as Osmosensor SHO1) functions as a membrane-associated sensor protein involved in detecting and responding to changes in environmental osmolarity . In yeast systems, SHO1 typically acts as part of a signaling cascade that helps cells adapt to hyperosmotic conditions by triggering appropriate cellular responses.

Based on the amino acid sequence provided in the search results, P. angusta SHO1 consists of 282 amino acids with multiple hydrophobic regions consistent with transmembrane domains . These membrane-spanning segments allow the protein to sense osmotic changes at the cell surface and transduce these signals to intracellular components of the signaling pathway. The detailed sequence reveals features typical of membrane-associated osmosensors, including hydrophobic transmembrane regions and potential interaction domains for downstream signaling proteins.

How do methylotrophic yeasts like Pichia angusta affect the properties of recombinant proteins?

Methylotrophic yeasts such as Pichia angusta (Hansenula polymorpha) significantly influence the properties of recombinant proteins through their distinct post-translational modification patterns, particularly glycosylation. Comparative studies with Pichia pastoris have revealed several important effects:

  • Glycosylation extent: P. angusta typically produces higher levels of glycosylation compared to P. pastoris. When expressing the same recombinant protein, P. angusta versions showed approximately 35% carbohydrate content versus 25% in P. pastoris .

  • Glycosylation pattern: P. angusta produces more heterogeneous glycosylation, evidenced by "spread bands" on SDS-PAGE analysis, indicating diverse high-mannose glycosylation patterns. This contrasts with the more defined bands observed in P. pastoris-expressed proteins .

  • Thermal stability: The increased glycosylation in P. angusta correlates with enhanced thermal stability of recombinant proteins. For example, recombinant endoglucanase from P. angusta retained significantly higher activity at elevated temperatures (60-80°C) compared to the same protein expressed in P. pastoris .

  • pH optima shifts: Recombinant enzymes expressed in P. angusta often display slightly shifted pH optima compared to those expressed in P. pastoris, as observed with endoglucanase II (pH 4.8 vs. 4.2) .

These characteristics make P. angusta particularly valuable for expressing proteins intended for applications requiring thermal stability, such as industrial enzymes that must function at elevated temperatures.

How do the biochemical properties of recombinant proteins expressed in Pichia angusta compare with those from other yeast expression systems?

Comparative studies between Pichia angusta (Hansenula polymorpha) and Pichia pastoris have revealed significant differences in the biochemical properties of recombinant proteins expressed in these systems. These differences are summarized in the following table:

PropertyPichia angusta (H. polymorpha)Pichia pastorisSignificance
Glycosylation extentHigher (~35% carbohydrate)Lower (~25% carbohydrate)Affects stability and activity
Glycosylation patternHeterogeneous, "spread bands"More homogeneousImpacts protein recognition and half-life
Apparent molecular weightHigher (e.g., ~63 kDa for EGII)Lower (e.g., ~53 kDa for EGII)Affects mobility, solubility
pH optimumSlightly higher (e.g., pH 4.8)Slightly lower (e.g., pH 4.2)Important for application conditions
Thermal stability at 80°CHigher (e.g., 69% retention)Lower (e.g., 48% retention)Critical for high-temperature applications
Catalytic efficiencyLower kcat/KmHigher kcat/KmDetermines enzyme effectiveness
Activity on natural substratesLower (e.g., 0.356 FPU)Higher (e.g., 0.7 FPU)Relevant for industrial applications

These differences highlight that the choice between expression systems should be guided by the specific requirements of the target protein and its intended application . For thermostable enzymes or proteins requiring stability at elevated temperatures, P. angusta offers advantages, while P. pastoris may be preferable when higher catalytic efficiency is the priority.

What methods can be used to verify successful genomic integration of the SHO1 gene in Pichia angusta?

Verification of successful genomic integration of the SHO1 gene in Pichia angusta requires multiple complementary approaches, based on established protocols for similar recombinant proteins:

  • PCR verification: Design gene-specific primers (forward and reverse) that amplify the SHO1 coding sequence. Using genomic DNA extracted from transformed colonies as template, successful integration will produce a band of approximately 850 bp (corresponding to the 282-amino acid SHO1 coding sequence) . The search results demonstrate this approach was successful for verifying integration of the egII gene, which produced a band at 1200 bp .

  • Southern blot analysis: To determine copy number and integration pattern, genomic DNA from transformed strains can be digested with appropriate restriction enzymes, separated by electrophoresis, and probed with a labeled SHO1-specific probe. This helps distinguish between single and multiple integration events.

  • Expression analysis:

    • RT-PCR to detect SHO1 mRNA transcripts

    • Western blotting using antibodies against SHO1 or its tag to verify protein expression

    • Functional complementation in SHO1-deficient yeast strains, similar to the approach used with Rad51 from P. angusta in S. cerevisiae

  • Stability testing: Following the approach described in the search results, transformants should be grown for multiple generations (30-80) under selective conditions to increase plasmid copy number and promote integration, followed by growth in non-selective medium to eliminate episomal plasmids, and finally growth in selective medium to verify stable integration .

  • Whole genome sequencing: For comprehensive verification, next-generation sequencing can confirm both the presence and precise location of the integrated SHO1 gene.

This systematic approach ensures that the SHO1 gene has been stably integrated into the P. angusta genome and is being properly expressed.

What mechanisms contribute to the thermal stability of proteins expressed in thermotolerant yeasts like Pichia angusta?

The remarkable thermal stability of proteins expressed in Pichia angusta stems from multiple molecular mechanisms:

  • Enhanced glycosylation: Recombinant proteins expressed in P. angusta display higher glycosylation levels (~35% carbohydrate content) compared to those expressed in P. pastoris (~25%) . This extensive glycosylation has been directly correlated with increased thermal stability, as shown in comparative studies of endoglucanase II where the P. angusta-expressed enzyme retained significantly higher activity at elevated temperatures .

  • Specialized folding machinery: As a thermotolerant organism, P. angusta possesses chaperones and folding enzymes adapted to function at higher temperatures. These may promote more thermostable conformations during recombinant protein folding.

  • Evolutionary adaptations: P. angusta proteins have evolved structural features that enhance stability at elevated temperatures. For example, the Rad51 protein from P. angusta was 20-fold more thermostable at 37°C than its Saccharomyces cerevisiae homolog and maintained enzymatic activities up to 52-54°C .

  • Temperature-dependent conformational changes: Some P. angusta proteins, like Rad51, demonstrate optimal activity only at elevated temperatures (above 42°C) , suggesting temperature-dependent conformational changes that activate the protein at its natural operating temperature.

  • Diverse glycosylation patterns: P. angusta produces heterogeneous glycosylation patterns that may provide broader thermal protection compared to the more homogeneous patterns seen in other expression systems .

These mechanisms collectively contribute to the superior thermal stability of recombinant proteins expressed in P. angusta, making this host particularly valuable for proteins intended for high-temperature applications.

How can codon optimization improve expression of SHO1 protein in Pichia angusta?

Codon optimization is a critical strategy for maximizing SHO1 expression in Pichia angusta, addressing several key factors that influence heterologous protein production:

The effectiveness of codon optimization for P. angusta is demonstrated in the search results, where synthesized genes with optimized codon preferences were successfully expressed under the control of specific promoters (AOX1 for P. pastoris and FMD for H. polymorpha) .

What transformation protocols are most effective for introducing the SHO1 gene into Pichia angusta?

Based on the search results, electroporation represents the most effective transformation method for introducing the SHO1 gene into Pichia angusta. The detailed protocol involves several critical steps:

  • Vector preparation:

    • Clone the SHO1 gene into a suitable expression vector containing:

      • A selectable marker (such as URA3 for uracil auxotrophic strains like H. polymorpha RB11)

      • An appropriate promoter (such as the methanol-inducible FMD promoter used for H. polymorpha)

      • Proper transcription termination sequences

  • Electroporation procedure:

    • Prepare electrocompetent P. angusta cells by washing in ice-cold sorbitol

    • Mix cells with the expression vector (either circular or linearized depending on the integration strategy)

    • Perform electroporation using optimized parameters:

      • For H. polymorpha RB11: 2000 V, 200 Ω, and 25 μF with a 0.2 cm cuvette

    • Immediately add 1 mL of ice-cold 1 M sorbitol after electroporation

    • Incubate for 60 minutes at 28°C before plating on selective media

  • Selection and stabilization:

    • Select transformants on appropriate media lacking the auxotrophic marker (e.g., YNB-Glucose without uracil for URA3-based selection)

    • Grow transformants for 30-80 generations under selective conditions to increase plasmid copy number and promote integration

    • Perform stabilization in non-selective medium to eliminate episomal plasmids

    • Final selection on selective medium to identify clones with stable genomic integration

  • Verification of integration:

    • Perform PCR using SHO1-specific primers on genomic DNA from putative transformants

    • Analyze expression levels of multiple clones to identify high-producing strains

This approach has been successfully used for introducing other genes into P. angusta, as demonstrated by the integration of the egII gene in the search results .

What expression systems and induction protocols are optimal for producing recombinant SHO1 in Pichia angusta?

Optimal expression of recombinant SHO1 in Pichia angusta requires careful selection of expression systems and induction protocols:

  • Promoter selection:

    • The FMD (formate dehydrogenase) promoter: A methanol-inducible promoter commonly used in H. polymorpha that provides strong, controlled expression

    • Alternative promoters include MOX (methanol oxidase) or DHAS (dihydroxyacetone synthase), which are also methanol-inducible

  • Vector construction:

    • Include appropriate signal sequences if secretion is desired (e.g., S. cerevisiae α-mating factor signal peptide)

    • Add affinity tags to facilitate purification while considering the membrane-bound nature of SHO1

    • Ensure proper transcription termination signals

  • Induction protocol:

    • Growth phase: Initial biomass accumulation in glucose or glycerol medium

    • Induction phase: Switch to methanol-containing medium for promoter activation

    • Methanol concentration: Maintain at 0.5-1% (v/v), replenishing as consumed

    • Duration: Typically 48-96 hours of induction for maximum protein accumulation

  • Culture conditions:

    • Temperature: Exploit P. angusta's thermotolerance by maintaining cultures at 30-37°C, which may enhance proper folding of SHO1

    • pH: Buffer to 5.5-6.5 for optimal growth and expression

    • Aeration: Ensure high dissolved oxygen levels as methanol metabolism is highly oxygen-demanding

  • Medium composition:

    • Buffered minimal medium with appropriate nitrogen sources

    • Trace elements supplementation for optimal cell growth

    • Consider supplementing with casamino acids to enhance expression

  • Scale-up considerations:

    • Implement fed-batch strategies for methanol feeding in larger fermentations

    • Monitor dissolved oxygen and methanol levels continuously

    • Adjust feeding rates based on oxygen consumption patterns

The search results demonstrate successful expression of other recombinant proteins in P. angusta using the FMD promoter, which could serve as a model for SHO1 expression .

What purification strategies are most effective for isolating membrane-bound proteins like SHO1 from Pichia angusta?

Purifying membrane-bound proteins like SHO1 from Pichia angusta requires specialized approaches to maintain structural integrity and function:

  • Cell disruption and membrane isolation:

    • Mechanical disruption methods (bead-beating, homogenization) at 4°C

    • Differential centrifugation to isolate membrane fractions:

      • Low-speed centrifugation (1,000-5,000 × g) to remove cell debris

      • High-speed centrifugation (100,000 × g) to collect membrane fractions

  • Membrane protein solubilization:

    • Selection of appropriate detergents:

      • Mild detergents (DDM, LMNG, digitonin) to maintain protein structure

      • Optimization of detergent concentration (typically 1-2% for extraction)

    • Solubilization buffer composition:

      • Include glycerol (10-20%) to enhance stability

      • Add protease inhibitors to prevent degradation

      • Maintain appropriate ionic strength and pH

  • Affinity purification:

    • Tag selection considerations:

      • The search results indicate that "The tag type will be determined during production process" for the SHO1 protein

      • Common options include polyhistidine, FLAG, or Strep tags

    • Chromatography conditions:

      • Include detergent at concentrations above CMC in all buffers

      • Use gentle elution conditions to prevent protein denaturation

      • Consider on-column detergent exchange if needed

  • Additional purification steps:

    • Size exclusion chromatography to:

      • Remove protein aggregates

      • Separate protein-detergent complexes from free detergent

      • Analyze oligomeric state

    • Ion exchange chromatography as a polishing step

  • Quality assessment:

    • SDS-PAGE analysis to verify purity

    • Western blotting to confirm identity

    • Circular dichroism to assess secondary structure integrity

    • Dynamic light scattering to evaluate homogeneity

  • Storage conditions:

    • Store in Tris-based buffer with 50% glycerol as indicated in the search results

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

These specialized approaches address the challenges inherent in membrane protein purification and increase the likelihood of obtaining functional SHO1 protein for subsequent analyses.

How can researchers assess the functional integrity of purified recombinant SHO1 protein?

Assessing the functional integrity of purified recombinant SHO1 protein requires multiple complementary approaches that evaluate both structural integrity and osmosensing functionality:

  • Structural integrity assessments:

    • Circular dichroism (CD) spectroscopy to verify proper secondary structure folding

    • Fluorescence spectroscopy to examine tertiary structure

    • Limited proteolysis patterns compared to native protein

    • Thermal shift assays to determine stability and proper folding

    • Size exclusion chromatography to assess oligomeric state

  • Membrane insertion verification:

    • Reconstitution into liposomes or nanodiscs

    • Flotation assays to confirm membrane association

    • Proteoliposome permeability assays

  • Functional complementation:

    • Expression in SHO1-deficient yeast strains

    • Assessment of growth under osmotic stress conditions

    • Measurement of downstream signaling pathway activation

    • This approach is conceptually similar to the complementation tests conducted with Rad51 from P. angusta in S. cerevisiae rad51Δ strains described in the search results

  • Protein-protein interaction studies:

    • Pull-down assays with known interaction partners

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for binding thermodynamics

    • Microscale thermophoresis to detect interactions in solution

  • Osmosensing functionality:

    • Reconstitution in giant unilamellar vesicles with osmolarity-dependent fluorescent indicators

    • FRET-based conformational change assays in response to osmotic shifts

    • Patch-clamp studies if ion channel activities are associated

  • Temperature-dependent activity analysis:

    • Given P. angusta's thermotolerance, assess functional parameters across a temperature range (30-52°C)

    • The search results indicate that some P. angusta proteins (like Rad51) show optimal activity only at temperatures above 42°C , suggesting SHO1 might also have temperature-dependent functional characteristics

These multifaceted approaches provide comprehensive assessment of whether the recombinant SHO1 protein maintains its native structural and functional properties, which is particularly important for membrane proteins that are challenging to express and purify in functional form.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.