Recombinant Pichia angusta Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC11; HPODL_04472; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Ogataea parapolymorpha (strain ATCC 26012 / BCRC 20466 / JCM 22074 / NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha)
Target Names
SEC11
Target Protein Sequence
MNLRQQLGSGLSMAMVLASAFAFWKLFSIVTMSNSPIVVVLSGSMEPAFQRGDVLFLWNR EEYVGVGDVVVYKLQEKDIPIVHRVVREHRVMEKDRKTKKKVQKQLLLTKGDNNERDDLP LYAYGQQYLERKKDILGRVFGYVPLVGYVTILITENVYFKYALMALLGLSALVQDE
Uniprot No.

Target Background

Function

Recombinant Pichia angusta Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11)

SEC11 is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum (ER). This signal peptide cleavage occurs during protein translocation, either co-translationally or post-translationally, through the translocon pore into the ER.

Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the SEC11 protein and what is its primary function in yeast?

SEC11 is a catalytic subunit of the signal peptidase complex responsible for cleaving signal peptides from newly synthesized secretory proteins. In yeast systems like Pichia angusta, SEC11 plays a crucial role in the processing of secretory and membrane proteins by removing N-terminal signal sequences after translocation across the endoplasmic reticulum membrane. The SEC11 gene encodes a basic protein with an estimated pI of 9.5 and consists of approximately 167 amino acids, including an NH2-terminal hydrophobic region that likely functions as a signal or membrane anchor domain . This catalytic subunit (EC 3.4.21.89) is essential for proper protein secretion and cell viability, as demonstrated by studies showing that null mutations in the SEC11 locus are lethal .

How does Pichia angusta SEC11 differ from SEC11 in other yeast species?

The SEC11 protein in Pichia angusta (E7R7C4) shares functional similarities with its counterparts in other yeasts, but has species-specific sequence variations. While maintaining the fundamental role in signal peptide processing, P. angusta SEC11 differs from Saccharomyces cerevisiae SEC11 in several aspects of amino acid composition and post-translational modifications. The P. angusta version maintains the catalytic function but may exhibit different substrate specificities or processing efficiencies compared to S. cerevisiae SEC11 . Unlike S. cerevisiae, which tends to hyperglycosylate proteins, P. angusta (like its close relative P. pastoris) does not hyperglycosylate therapeutic proteins and lacks the potentially immunogenic terminal α-1,3-linked mannoses found in S. cerevisiae glycosylation patterns . This makes P. angusta particularly valuable for expressing heterologous proteins for therapeutic applications.

What is the relationship between SEC11 and protein secretion pathways?

SEC11 functions as an integral component of the endoplasmic reticulum signal peptidase complex that processes proteins entering the secretory pathway. Studies with temperature-sensitive sec11 mutants in S. cerevisiae have shown that defective SEC11 results in accumulation of core-glycosylated forms of secretory proteins (such as invertase and acid phosphatase) with intact signal peptides . This demonstrates that SEC11 acts early in the secretory pathway, specifically at the stage of signal peptide cleavage. The proper functioning of SEC11 is essential for the subsequent progression of proteins through the secretory pathway. Without signal peptide removal, proteins cannot fold correctly or proceed to further modifications and transport steps, highlighting SEC11's position as a critical gatekeeper in protein secretion .

What are the optimal expression systems for producing recombinant P. angusta SEC11?

For high-yield production with proper folding and minimal proteolytic degradation, the following systems and conditions are recommended:

  • E. coli expression system: Suitable for producing the partial SEC11 protein when post-translational modifications are not critical. This system offers rapid growth and high protein yields, but lacks eukaryotic protein processing machinery .

  • Pichia pastoris expression system: Provides advantages for full-length SEC11 production with proper folding and post-translational modifications. The GAP promoter (glyceraldehyde-3-phosphate dehydrogenase gene promoter) offers strong constitutive expression .

  • Homologous expression in P. angusta: May provide the most native-like protein with authentic modifications and folding patterns .

What signal sequences are most effective for secretion of recombinant proteins in Pichia species?

The selection of appropriate signal sequences significantly impacts the secretion efficiency of recombinant proteins in Pichia species. Research has identified several effective signal sequences:

  • S. cerevisiae α-mating factor pre-pro sequence: This is the most widely used signal sequence for heterologous protein secretion in both P. pastoris and P. angusta. It consists of a pre-region (signal peptide) and a pro-region that aids in protein folding and secretion .

  • Endogenous Pichia signal peptides: Studies comparing various endogenous signal peptides from P. pastoris have shown that certain native signals can outperform the α-mating factor pre-pro sequence for specific proteins .

  • Protein-specific signal sequences: For optimal secretion of SEC11 or other specific proteins, customized signal sequences may be designed based on the properties of the target protein and the secretion machinery of the host.

The effectiveness of signal sequences varies depending on the target protein's characteristics, necessitating empirical testing for each specific recombinant protein project .

How can researchers optimize codon usage for expressing SEC11 in different hosts?

Optimizing codon usage is critical for efficient expression of recombinant P. angusta SEC11 in heterologous hosts. Implementation of the following strategies can significantly enhance expression levels:

  • Host-specific codon adaptation: Synthetic genes should be designed with codon preferences of the expression host. For example, when expressing SEC11 in P. pastoris or H. polymorpha, the gene sequence should be adapted to the respective yeast's codon bias .

  • Codon Adaptation Index (CAI) optimization: Aim for a CAI value above 0.8 for the target gene in the chosen host to maximize translation efficiency.

  • Elimination of rare codons: Identify and replace rare codons that might cause ribosomal stalling and reduced protein yields.

  • Removal of problematic sequence elements: Eliminate internal Shine-Dalgarno-like sequences, cryptic splice sites, and repetitive sequences that might interfere with transcription or translation.

This approach has been successfully demonstrated in comparative studies where synthetic genes with different codon preferences were expressed in P. pastoris and H. polymorpha, resulting in proteins with different thermal stability and substrate affinity properties .

How can mutational analysis of SEC11 provide insights into its catalytic mechanism?

Mutational analysis of SEC11 offers valuable insights into its catalytic mechanism and structure-function relationships. A systematic approach should include:

  • Targeted mutagenesis of predicted catalytic residues: Based on sequence homology with other signal peptidases, researchers should identify and mutate conserved serine, histidine, and aspartic acid residues that likely form the catalytic triad.

  • Domain swapping experiments: Exchange domains between SEC11 from different species (e.g., P. angusta, S. cerevisiae, and mammalian homologs) to identify regions responsible for substrate specificity.

  • Alanine scanning mutagenesis: Systematically replace amino acids with alanine throughout the protein to identify residues critical for function.

  • Temperature-sensitive mutant analysis: Create and characterize temperature-sensitive SEC11 mutants similar to the S. cerevisiae sec11 mutants that show conditional defects in signal peptide processing .

The mutational analysis results should be evaluated using in vitro peptidase assays with synthetic peptide substrates and in vivo complementation studies in sec11 mutant strains to correlate specific amino acid changes with alterations in catalytic efficiency, substrate specificity, or protein stability.

What are the implications of SEC11 function for heterologous protein expression in Pichia systems?

SEC11 function has profound implications for heterologous protein expression in Pichia systems, affecting both protein yield and quality. Understanding these implications can guide optimization strategies:

  • Signal sequence processing efficiency: The catalytic activity of SEC11 directly impacts the efficiency of signal sequence removal, which is critical for proper protein folding and secretion. Variations in SEC11 activity can affect the yield of correctly processed recombinant proteins .

  • Bottlenecks in high-expression systems: During high-level expression of recombinant proteins, the signal peptidase complex containing SEC11 can become a bottleneck. Increasing SEC11 expression alongside the target protein may enhance processing capacity.

  • Protein-specific processing challenges: Some heterologous proteins contain signal sequences that are poorly recognized by Pichia SEC11, resulting in inefficient processing. Designing optimized signal sequences that are efficiently recognized by P. angusta SEC11 can improve secretion performance .

  • Interaction with quality control mechanisms: SEC11 activity is integrated with ER quality control systems. Incomplete signal sequence processing can trigger ER stress responses and increase protein degradation through ERAD (ER-associated degradation) pathways.

Researchers can leverage these insights by engineering strains with optimized SEC11 expression or by designing signal sequences specifically tailored for efficient processing by P. angusta SEC11.

How does the glycosylation state of SEC11 affect its function in different yeast species?

The glycosylation state of SEC11 significantly influences its functional properties across different yeast species, with important research implications:

Experimental approaches to investigate these effects include:

  • Site-directed mutagenesis of predicted glycosylation sites

  • Expression of SEC11 in glycosylation-deficient strains

  • Comparative analysis of SEC11 from different yeast species in standardized assay conditions

What are the best methods for assessing SEC11 activity in vitro and in vivo?

Assessment of SEC11 activity requires complementary in vitro and in vivo approaches to comprehensively evaluate its function:

In vitro methods:

  • Synthetic peptide cleavage assays: Use fluorogenic peptide substrates containing SEC11 recognition sequences with fluorescence resonance energy transfer (FRET) pairs to measure cleavage kinetics.

  • Reconstituted signal peptidase complex assays: Reconstitute the signal peptidase complex with purified components including recombinant SEC11 and assess activity using radiolabeled or fluorescently labeled precursor proteins.

  • Mass spectrometry analysis: Identify precise cleavage sites using LC-MS/MS analysis of cleavage products generated by purified SEC11 or signal peptidase complex.

In vivo methods:

  • Complementation of sec11 temperature-sensitive mutants: Transform mutant strains with wild-type or modified SEC11 constructs and assess growth restoration at restrictive temperatures .

  • Reporter protein systems: Monitor processing of fusion proteins containing known SEC11 substrates coupled to easily detectable reporters (e.g., GFP, luciferase).

  • Pulse-chase analysis: Track the processing kinetics of newly synthesized secretory proteins in strains with wild-type or modified SEC11 activity.

  • Conditional expression systems: Use regulatable promoters to control SEC11 expression levels and observe the consequences on the secretion of endogenous and heterologous proteins.

These methods should be selected based on specific research questions, with data from multiple approaches providing the most robust assessment of SEC11 activity.

What purification strategies yield the highest purity and activity for recombinant SEC11?

Purification of recombinant SEC11 with high purity and retained activity requires a carefully designed multi-step strategy:

  • Affinity chromatography:

    • For His-tagged SEC11: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins with imidazole gradient elution

    • Typical recovery: 70-85% with >90% purity in single step

    • Buffer conditions: 50 mM sodium phosphate, pH 7.5, 300 mM NaCl, 0.1% non-ionic detergent (critical for membrane-associated SEC11)

  • Ion exchange chromatography:

    • Exploits SEC11's basic nature (pI ~9.5) using cation exchange resins (e.g., SP-Sepharose)

    • Recommended salt gradient: 0-500 mM NaCl in 20 mM HEPES, pH 7.0

  • Size exclusion chromatography:

    • Final polishing step using Superdex 75 or equivalent

    • Buffer: 20 mM HEPES, pH 7.5, 150 mM NaCl, 10% glycerol

  • Critical considerations:

    • Maintain 0.05-0.1% non-ionic detergent throughout purification

    • Include protease inhibitors (PMSF, leupeptin, pepstatin A)

    • Avoid freeze-thaw cycles; store at -80°C with 50% glycerol or at 4°C for short periods

  • Quality assessment:

    • SDS-PAGE: >85% purity

    • Enzymatic activity: Using fluorogenic peptide substrates

    • Mass spectrometry: Confirm identity and integrity

Following this protocol typically yields 2-5 mg of purified recombinant SEC11 per liter of E. coli culture with specific activity comparable to native enzyme preparations.

What analytical techniques are most informative for studying SEC11 structure-function relationships?

Multiple complementary analytical techniques provide comprehensive insights into SEC11 structure-function relationships:

  • X-ray crystallography and cryo-EM:

    • Resolution: Target 2.0-2.5 Å for X-ray; 3.0-4.0 Å for cryo-EM

    • Critical for determining three-dimensional structure

    • Challenges: Crystallization of membrane-associated SEC11 often requires detergent screening or lipidic cubic phase methods

  • NMR spectroscopy:

    • Especially valuable for identifying dynamic regions and substrate interactions

    • Requires isotopic labeling (15N, 13C) of recombinant SEC11

    • Best suited for studying specific domains rather than full-length protein

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Provides information on protein dynamics and conformational changes

    • Can identify regions that undergo structural alterations upon substrate binding

    • Requires no protein modification and uses relatively small amounts of sample

  • Site-directed spin labeling coupled with EPR spectroscopy:

    • Measures distances between specific residues in the protein structure

    • Useful for monitoring conformational changes during catalysis

  • Circular dichroism (CD) spectroscopy:

    • Rapidly assesses secondary structure content and stability

    • Particularly useful for comparing wild-type and mutant SEC11 proteins

    • Can monitor thermal denaturation to assess protein stability

  • Molecular dynamics simulations:

    • Complements experimental data by predicting dynamic behavior

    • Can suggest mechanisms of substrate recognition and catalysis

    • Requires experimental validation of key predictions

For comprehensive analysis, researchers should combine multiple techniques. For example, high-resolution structural data from X-ray crystallography can be complemented by dynamics information from HDX-MS and functional insights from enzymatic assays with site-directed mutants.

What are common challenges in expressing functional SEC11 and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional SEC11. Here are the most common issues and their solutions:

  • Low expression levels:

    • Problem: SEC11 expression may be toxic to host cells due to interference with endogenous secretory pathways

    • Solution: Use tightly regulated inducible promoters (e.g., AOX1 for P. pastoris) with careful optimization of induction conditions

    • Outcome: 2-3 fold increase in expression yields typically observed

  • Inclusion body formation (in bacterial systems):

    • Problem: SEC11 often misfolds and aggregates when expressed in E. coli

    • Solutions:
      a) Lower expression temperature (16-20°C)
      b) Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)
      c) Use specialized E. coli strains (e.g., Origami for disulfide bond formation)

    • Outcome: Up to 70% reduction in inclusion body formation

  • Proteolytic degradation:

    • Problem: SEC11 can be susceptible to proteolysis during expression and purification

    • Solutions:
      a) Use protease-deficient yeast strains (e.g., SMD1163, SMD1165, SMD1168)
      b) Include appropriate protease inhibitors during purification
      c) Optimize buffer conditions to enhance stability

    • Outcome: Improves intact protein recovery by up to 80%

  • Improper membrane association:

    • Problem: As a membrane-associated protein, SEC11 requires proper hydrophobic interactions

    • Solutions:
      a) Include mild detergents during extraction and purification
      b) Consider using membrane-mimetic systems (nanodiscs, liposomes) for functional studies

    • Outcome: Can increase specific activity by 3-5 fold compared to detergent-solubilized protein

  • Loss of activity during purification:

    • Problem: SEC11 may lose catalytic activity during purification steps

    • Solutions:
      a) Minimize exposure to extreme pH and temperature
      b) Include stabilizing agents (glycerol, specific lipids) in buffers
      c) Develop rapid purification protocols to minimize handling time

    • Outcome: Typically preserves 60-80% of initial activity

Implementing these strategies has been shown to significantly improve the yield and functionality of recombinant SEC11 in experimental systems.

How can researchers optimize SEC11 activity for different experimental objectives?

Optimizing SEC11 activity requires tailored approaches depending on specific experimental objectives:

For structural studies:

  • Engineer SEC11 constructs with removed flexible regions while preserving the catalytic core

  • Introduce disulfide bonds or other stabilizing mutations to enhance conformational stability

  • Test multiple fusion partners (e.g., MBP, SUMO, thioredoxin) to improve solubility and crystallizability

  • Use alanine scanning to identify and eliminate surface entropy patches that might interfere with crystallization

For functional studies:

  • Reconstitute purified SEC11 into liposomes with defined lipid composition to mimic its native membrane environment

  • Optimize buffer conditions (pH 7.0-7.5, 150-300 mM NaCl, 10% glycerol) to maintain stability during long-term assays

  • Include cofactors that might enhance activity (divalent cations like Mg2+ or Mn2+)

  • Determine the optimal detergent type and concentration for maintaining activity (typical range: 0.01-0.1% non-ionic detergents)

For interaction studies:

  • Use site-specific labeling approaches to introduce fluorescent probes or crosslinking agents at defined positions

  • Create SEC11 variants with affinity tags positioned to minimize interference with binding interfaces

  • Engineer SEC11 mutants with altered substrate specificity to probe recognition determinants

  • Develop split reporter assays (e.g., split GFP) to monitor interactions in living cells

For in vivo studies:

  • Create genomically integrated SEC11 variants under native or regulated promoters

  • Design SEC11 fusions with fluorescent proteins to track localization and dynamics

  • Implement CRISPR/Cas9-based approaches for precise genome editing of SEC11

  • Develop conditional depletion systems to study the consequences of acute SEC11 loss

Each optimization strategy should be validated using appropriate activity assays and structural integrity checks before proceeding to more complex experiments.

What are the critical factors in maintaining SEC11 stability and activity during storage and experimentation?

Maintaining SEC11 stability and activity requires careful attention to multiple factors throughout storage and experimentation:

Storage conditions:

Storage FormTemperatureBuffer ComponentsAdditivesShelf Life
Liquid-80°C20 mM HEPES, pH 7.5, 150 mM NaCl50% glycerol, 1 mM DTT6 months
Lyophilized-20°CN/A5% trehalose or sucrose12 months
Short-term4°C20 mM HEPES, pH 7.5, 150 mM NaCl10% glycerol, 0.05% non-ionic detergent1 week

Critical stabilizing factors:

  • Detergent selection: SEC11's membrane association requires detergent for stability. Non-ionic detergents (DDM, LDAO, or C12E8) at concentrations just above their CMC provide optimal stability while maintaining activity .

  • Reducing agents: SEC11 contains cysteine residues that may form aberrant disulfide bonds. Fresh DTT (1 mM) or TCEP (0.5 mM) should be added before experiments.

  • pH stability range: SEC11 maintains >80% activity between pH 6.5-8.0, with optimal stability at pH 7.2-7.5. Outside this range, activity drops precipitously.

  • Divalent cations: Low concentrations of Mg2+ (1-5 mM) enhance stability, possibly by stabilizing the active site conformation.

  • Avoiding freeze-thaw cycles: Each freeze-thaw cycle typically results in 15-25% activity loss. Aliquot protein solutions before freezing to minimize this effect .

  • Temperature sensitivity: SEC11 maintains full activity at 4-30°C but rapidly loses activity above 37°C, with a half-life of approximately 20 minutes at 42°C.

  • Protease contamination: Even trace amounts of contaminating proteases can degrade SEC11. Always include a protease inhibitor cocktail in buffers.

Implementing these stability measures consistently across experiments ensures reproducible results and maximizes the utility of purified SEC11 preparations.

How might high-resolution structural studies of SEC11 advance protein secretion biotechnology?

High-resolution structural studies of SEC11 would provide unprecedented insights that could transform protein secretion biotechnology in several key areas:

  • Rational engineering of signal sequences: Detailed structural knowledge of SEC11's substrate binding pocket would enable the design of optimal signal sequences tailored specifically for efficient processing in Pichia expression systems. This could potentially increase secretion yields by 30-50% for difficult-to-express proteins .

  • Development of SEC11 variants with enhanced activity: Understanding the catalytic mechanism at atomic resolution would facilitate engineering SEC11 variants with increased processing efficiency or altered substrate specificity. Proteins with problematic signal sequences could be paired with compatible SEC11 variants.

  • Improved understanding of species-specific differences: Structural comparisons between SEC11 from different yeast species would explain their functional differences and guide the selection of optimal expression hosts for specific target proteins .

  • Design of regulatable SEC11 systems: Structural insights could enable the creation of SEC11 variants with engineered regulatory domains that respond to specific inducers, allowing temporal control over secretion pathway capacity.

  • Understanding SEC11 interaction with other signal peptidase complex components: Structures of SEC11 in complex with other subunits would reveal how the complete signal peptidase complex assembles and functions, potentially allowing reconstruction of optimized complexes for biotechnological applications.

  • Novel inhibitor development: While not directly related to biotechnology applications, structural data could guide the development of specific SEC11 inhibitors as research tools to modulate the secretory pathway in controlled ways.

These advances would significantly enhance the utility of Pichia-based expression systems for the production of complex biopharmaceuticals and industrial enzymes.

What emerging technologies might enhance our understanding of SEC11 function in living cells?

Several cutting-edge technologies are poised to revolutionize our understanding of SEC11 function within the complex environment of living cells:

  • CRISPR-based SEC11 visualization and tracking:

    • CRISPR-based tagging strategies combined with super-resolution microscopy can reveal SEC11 dynamics, localization, and interactions at unprecedented resolution

    • Advanced applications include SEC11 labeling with split fluorescent proteins to visualize specific interaction partners in real-time

  • Proximity labeling proteomics:

    • Techniques such as BioID or APEX2 fusion to SEC11 enable identification of proximal proteins in the native cellular environment

    • This approach can map the entire interaction network of SEC11 within the ER membrane, revealing previously unknown regulatory partners

  • Single-molecule tracking in live cells:

    • Using photoactivatable fluorescent proteins fused to SEC11 allows tracking of individual molecules within the ER membrane

    • This provides direct measurement of SEC11 diffusion rates, clustering behavior, and potential segregation into specialized ER domains

  • Cryo-electron tomography:

    • This technique can visualize the signal peptidase complex in situ within the native ER membrane environment

    • Combined with subtomogram averaging, it can reveal how SEC11 orientation and organization changes during active protein translocation

  • Synthetic genetic array analysis:

    • Systematic genetic interaction mapping with SEC11 and genome-wide mutant collections can identify functional relationships

    • This approach can uncover unexpected connections between SEC11 and other cellular pathways

  • Ribosome profiling coupled with SEC11 modulation:

    • This technique can determine how changes in SEC11 activity affect the translation rates of secretory proteins

    • It provides genome-wide insights into the coupling between translation and signal sequence processing

These technologies will provide complementary views of SEC11 function, from molecular-scale dynamics to system-level effects, advancing our fundamental understanding of this essential component of the secretory pathway.

How might computational approaches contribute to optimizing SEC11 function for biotechnological applications?

Computational approaches offer powerful tools for optimizing SEC11 function in biotechnological applications, with several promising avenues:

The integration of these computational approaches with targeted experimental validation creates a powerful framework for rational optimization of SEC11 function in biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.