Recombinant Pichia canadensis Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-247
Protein Length
Full Length of Mature Protein
Species
Wickerhamomyces canadensis (Yeast) (Pichia canadensis)
Target Names
COX2
Target Protein Sequence
DVPTPWGVYFQDSATPNHEGIIELHDNIMFYLVLILCLVSWLLFSIVKDGSKNPLPHKYL VHGQTIEIIWTILPALVLLVIAFPSFILLYLCDEVISPAMTIKAIGLQWYWKYEYSDFIN DSGETIEFESYVIPEDLLEDGQLPLLDTDTSIVCPVNTHIRFIVSAADVIHDFAVPSLGI KIDACPGRLNQVSALIQREGVYYGQCSELCGVAHSAMPIKVEAVSLKEFLTWLNEQ
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, involving three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. COX2 plays a crucial role in the catalytic reduction of oxygen to water within Complex IV. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center comprised of heme A3 and CuB) in subunit 1. This binuclear center utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Pichia canadensis Cytochrome c oxidase subunit 2 (COX2) and its role in cellular respiration?

Pichia canadensis Cytochrome c oxidase subunit 2 (COX2) is a critical component of complex IV (cytochrome c oxidase) in the mitochondrial electron transport chain. This protein plays an essential role in cellular respiration by facilitating electron transfer from cytochrome c to the enzyme's active site. The mature protein spans amino acids 12-247 and contains domains responsible for interaction with other respiratory complex subunits . COX2 functions as the initial electron acceptor in the oxygen reduction pathway, making it fundamentally important for oxidative phosphorylation and ATP production .

The electron transfer through COX2 follows a specific pathway:

  • Reduced cytochrome c from the intermembrane space binds to COX2

  • Electrons transfer from cytochrome c to the dinuclear copper A center (CuA) in COX2

  • Electrons then move to heme A in subunit 1

  • Finally, electrons reach the binuclear center formed by heme A3 and copper B

  • At this site, molecular oxygen is reduced to water using four electrons and four protons

This process contributes to the electrochemical gradient that ultimately drives ATP synthesis, making COX2 indispensable for aerobic energy production.

What expression systems are most effective for producing recombinant Pichia canadensis COX2?

Several expression systems have been employed for recombinant production of Pichia canadensis COX2, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, well-established protocols, high yieldPotential misfolding, limited post-translational modificationsModerate to high
Wheat germ cell-freeEukaryotic folding environment, good for membrane proteinsHigher cost, lower scalabilityLow to moderate
Yeast systems (S. cerevisiae, P. pastoris)Natural post-translational modifications, proper foldingLonger expression time, more complex protocolsModerate

The most documented approach is E. coli expression with N-terminal His-tagging for purification purposes, as evidenced in commercially available recombinant variants . For studies requiring authentic post-translational modifications and proper copper incorporation, yeast-based expression systems may provide advantages despite potentially lower yields.

When selecting an expression system, researchers should consider:

  • The intended experimental application

  • Requirements for protein activity and modifications

  • Available purification strategies

  • Scale of production needed

What are the optimal storage and handling conditions for recombinant COX2 protein?

Proper storage and handling of recombinant Pichia canadensis COX2 is critical for maintaining protein integrity and activity:

  • Long-term storage: Store lyophilized protein at -20°C/-80°C

  • Working storage: Keep reconstituted aliquots at 4°C for up to one week

  • Reconstitution: Use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Cryoprotection: Add glycerol (5-50% final concentration, with 50% being commonly used) for freeze-thaw protection

  • Buffer composition: Tris/PBS-based buffer, pH 8.0 with 6% trehalose has been shown to be effective

  • Freeze-thaw cycles: Avoid repeated cycles as they significantly degrade protein structure and function

When preparing the protein for experimental use, gentle handling techniques should be employed. Brief centrifugation of vials before opening ensures all material is collected at the bottom. For functional assays, maintaining the protein in conditions that mimic the native mitochondrial environment (including appropriate pH, ionic strength, and membrane-like surroundings) can help preserve enzymatic activity.

How does oxygen availability affect COX2 expression and function in Pichia species?

Oxygen availability has profound effects on COX2 expression and function in Pichia species, given its direct involvement in oxygen utilization:

Oxygen ConditionEffects on COX2Cellular AdaptationsResearch Implications
Normoxic (21% O₂)Baseline expression levelsStandard respiratory functionControl condition for comparative studies
Oxygen-limitingTranscriptional upregulationEnhanced respiratory capacityPotential strategy for improved protein production
Hypoxic (<1% O₂)Significant gene expression changesMetabolic rewiring, altered protein traffickingResearch opportunity for studying adaptation mechanisms

Studies in the related species P. pastoris have shown significant transcriptional responses to hypoxia, with distinct adaptations compared to S. cerevisiae . The adaptation to reduced oxygen involves coordinated changes in lipid metabolism, stress responses, protein folding, and trafficking pathways . These adaptations appear to be integrated with recombinant protein expression mechanisms, suggesting that controlled oxygen limitation could potentially enhance protein production in biotechnological applications.

For researchers working with Pichia canadensis, understanding these oxygen-dependent responses is critical for optimizing experimental conditions and interpreting results, particularly when studying mitochondrial function or protein expression under varying oxygen tensions.

What methodological approaches are optimal for studying COX2 protein-protein interactions?

Studying protein-protein interactions involving membrane-bound proteins like COX2 requires specialized methodological approaches:

MethodApplicationAdvantagesKey Considerations
Co-immunoprecipitationIdentifying native protein complexesPreserves physiological interactionsRequires specific antibodies, appropriate detergents
Bimolecular Fluorescence ComplementationVisualizing interactions in vivoDetects interactions in cellular contextProtein tagging may affect function
Surface Plasmon ResonanceMeasuring binding kineticsProvides quantitative binding constantsRequires purified components, membrane reconstitution
Hydrogen-Deuterium Exchange MSMapping interaction interfacesHigh resolution of binding regionsTechnically demanding, specialized equipment
Split-ubiquitin membrane Y2HScreening for novel interactorsAdapted for membrane proteinsMay produce false positives

For COX2 specifically, detergent selection for extraction and solubilization significantly impacts the preservation of physiologically relevant interactions. Digitonin and mild non-ionic detergents like DDM (n-dodecyl β-D-maltoside) have been shown to better preserve respiratory complex interactions compared to more aggressive detergents.

Researchers should consider employing complementary techniques to validate interactions identified by any single method. For studying interactions with nuclear-encoded partners, such as other subunits of the cytochrome c oxidase complex, it's crucial to consider the native mitochondrial environment and potential co-translational assembly mechanisms.

What are the key considerations when designing site-directed mutagenesis experiments for COX2?

When designing site-directed mutagenesis experiments for Pichia canadensis COX2, several critical factors should be considered:

ConsiderationRationaleImplementation Strategy
Functional domainsTarget mutations to specific functional regionsFocus on copper-binding sites, cytochrome c interaction domains
Evolutionary conservationIdentify constrained residuesUse multiple sequence alignments to identify highly conserved sites
Structural impactsMaintain protein folding and stabilityUse structural modeling to predict effects of mutations
Codon optimizationEnsure efficient expressionAdapt codons to the host system's preference
Selection strategyEnable identification of mutantsInclude phenotypic or antibiotic resistance markers
Functional assaysVerify consequences of mutationsDevelop appropriate activity assays

The copper-binding domains of COX2 are particularly critical targets, as they directly participate in electron transfer from cytochrome c. Previous evolutionary studies have identified codons under different selective pressures , providing valuable targets for mutagenesis. Residues under strong purifying selection (ω << 1) are likely essential for function, while those under relaxed selective constraint (ω = 1) may tolerate substitutions.

For researchers investigating structure-function relationships, a systematic approach targeting key domains—such as the copper-binding sites, transmembrane regions, and interaction interfaces with other complex IV subunits—can yield valuable insights into the molecular mechanisms of electron transfer and complex assembly.

How can researchers troubleshoot expression challenges specific to recombinant COX2?

Recombinant expression of mitochondrial membrane proteins like COX2 presents unique challenges that require systematic troubleshooting:

ChallengePotential CausesTroubleshooting Strategies
Poor expression yieldToxicity to host, inefficient transcriptionOptimize induction conditions, use regulated promoters, test different host strains
Protein insolubilityImproper folding, aggregationModify extraction conditions, use fusion tags, express at lower temperatures
Lack of activityMissing cofactors, improper foldingCo-express chaperones, supplement media with copper, ensure proper disulfide formation
DegradationProtease sensitivityAdd protease inhibitors, use protease-deficient strains, optimize purification speed
Improper localizationMissing targeting sequencesVerify signal peptide integrity, consider adding mitochondrial targeting sequences

For E. coli expression systems, the lack of appropriate post-translational modification machinery may limit functional expression of eukaryotic COX2 . In such cases, switching to a eukaryotic expression system might be beneficial, as it provides a more suitable environment for proper folding and modification.

Monitoring expression using western blotting with anti-His antibodies can help track protein production and stability. For functional assessment, spectroscopic methods to detect copper incorporation and electron transfer capability provide valuable information about protein quality.

What are the most reliable methods for assessing the enzymatic activity of recombinant COX2?

Assessing the enzymatic activity of recombinant COX2 requires specialized techniques focused on electron transfer capability:

Assay MethodMeasurement ParameterExperimental SetupLimitations
Oxygen ConsumptionRate of O₂ reductionClark-type electrode, respirometryRequires functional integration into complex IV
Cytochrome c OxidationRate of cytochrome c oxidationSpectrophotometric monitoring at 550 nmIndirect measure of COX2 function
Electron Paramagnetic ResonanceCuA center redox stateEPR spectrometer, low temperatureSpecialized equipment required
Copper Content AnalysisCopper incorporationAtomic absorption spectroscopyMeasures cofactor presence, not activity

It's important to note that isolated COX2 may not show full enzymatic activity without association with other subunits of the cytochrome c oxidase complex. For functional studies, reconstitution with other purified subunits or incorporation into artificial membrane systems (liposomes or nanodiscs) may be necessary.

The cytochrome c oxidation assay is particularly useful as it specifically measures the first step in the electron transfer process mediated by COX2. This assay can be performed by monitoring the decrease in absorbance at 550 nm as reduced cytochrome c becomes oxidized, providing a direct measure of electron transfer capability.

What techniques are effective for studying the evolutionary conservation of COX2?

Studying evolutionary conservation of COX2 across Pichia species and other organisms requires a multi-faceted approach:

TechniqueApplicationKey OutputsAnalytical Considerations
Comparative GenomicsSequence comparison across speciesSequence identity, substitution patternsRequires high-quality genome sequences
Selection Pressure AnalysisIdentifying evolutionary constraintsdN/dS ratios (ω), site-specific selectionMaximum likelihood models required
Ancestral Sequence ReconstructionTracing evolutionary historyInferred ancestral statesComputational intensity, model selection
Structural BioinformaticsMapping conservation onto structureStructure-function relationshipsDepends on available structural data
Co-evolution AnalysisIdentifying coordinated evolutionCorrelation between substitution patternsRequires large sequence datasets

Previous studies of COX2 in other organisms have revealed interesting evolutionary patterns. In the marine copepod Tigriopus californicus, interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions . This substantial variation provides a model for understanding how this critical gene tolerates sequence divergence while maintaining function.

Analysis of selection pressure through maximum likelihood models has identified that the majority of codons in COII are under strong purifying selection (ω << 1), while approximately 4% of sites appear to evolve under relaxed selective constraint (ω = 1) . Some sites may even experience positive selection within specific lineages, suggesting adaptive evolution in response to changing environmental conditions or co-evolution with interacting proteins.

How does post-translational modification affect the functionality of COX2?

Post-translational modifications (PTMs) significantly impact COX2 functionality in multiple ways:

Modification TypeSites in COX2Functional ImpactDetection Methods
Copper incorporationCuA centerEssential for electron transferAtomic absorption spectroscopy, EPR
Disulfide bond formationConserved cysteinesStructural stability, copper bindingNon-reducing SDS-PAGE, mass spectrometry
Proteolytic processingN-terminal regionMaturation and proper foldingN-terminal sequencing, mass spectrometry
PhosphorylationSer/Thr residuesActivity regulationPhospho-specific antibodies, LC-MS/MS

The incorporation of copper into the CuA center represents the most critical modification for COX2 function, as this directly enables electron transfer from cytochrome c. This process typically requires specialized copper chaperones in the mitochondrial intermembrane space. When expressing recombinant COX2, ensuring proper copper incorporation is a significant challenge, particularly in heterologous systems that may lack the appropriate copper delivery machinery.

Proteolytic processing is another important aspect of COX2 maturation. The protein is synthesized with an N-terminal extension that must be correctly processed for proper integration into the cytochrome c oxidase complex. In recombinant systems, this may necessitate co-expression of appropriate processing peptidases or careful design of the expression construct to include only the mature protein sequence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.