Recombinant Pichia canadensis Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Expression System

  • Host: Expressed in Escherichia coli (not Pichia pastoris) .

  • Purity: >90% as determined by SDS-PAGE .

Purification Protocol

StepMethodBufferNotes
Initial PurificationImmobilized Metal Affinity Chromatography (IMAC)Tris/PBS-based bufferLeveraging the His-tag for binding
Storage Buffer6% trehalose, pH 8.0Lyophilized powderAvoid repeated freeze-thaw cycles

Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for extended storage .

Experimental Uses

ApplicationDetailsSource
SDS-PAGEQuality control and purity assessment
ELISADetection and quantification in immunoassays
Mitochondrial StudiesInvestigating electron transport chain dynamics and complex IV assembly
Disease ModelingResearch on mitochondrial disorders linked to COX3 mutations (e.g., myopathy, encephalopathy)

Comparative Analysis with Human COX3

ParameterHuman COX3 (MT-CO3)Pichia canadensis COX3
UniProt IDP00414P48874
Length261 amino acids269 amino acids
Expression HostMitochondrial DNA-encodedRecombinant E. coli
Disease AssociationLeber hereditary optic neuropathy, MELASResearch focus on structural studies
Purification MethodNot applicable (endogenous)IMAC via His-tag

Functional Similarity: Both catalyze oxygen reduction in complex IV, but Pichia COX3 lacks the human-specific disease-linked mutations .

Research Considerations

  • Stability: Lyophilized preparations require careful reconstitution to maintain functionality .

  • Cross-Species Utility: While structurally homologous to human COX3, its use in human disease models requires validation .

  • Quality Control: Rigorous SDS-PAGE and ELISA validation are recommended for batch consistency .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Wickerhamomyces canadensis (Yeast) (Pichia canadensis)
Target Names
COX3
Target Protein Sequence
MTHLERSRHQLFPFHLVSPSPWPITVSFALMSFALSLGLTMHGYIVGNSVLFTSIILVLY SMTMWFRDIIAEGTYLGDHTLAVRKGLNYGFLLFVVSEILIFAGIFWAYFHSAMSPAIEI GGVWPPVGITAIGATELPLLNTIILLASGATITYSHHATIEGNRNHALNGLFITLWLIVI FVVCQYIEYTNAPFTISDGVYGSVFFAGTGLHFLHMGMLIIMLAVCYWRMRQYHFTTGHH VNYETTILYLHVLDVIWLFLYIVMYWWGA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a vital component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and the function of ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Cytochrome c oxidase subunit 3 (COX3) in cellular respiration?

Cytochrome c oxidase subunit 3 (COX3) is one of the three core subunits of the aa3-type cytochrome c oxidase. Unlike other subunits, COIII does not contain any redox centers but plays a significant role during the biosynthesis of the enzyme . While earlier research suggested its involvement in proton translocation, more recent studies show that COIII is not an essential element of the proton pump, as demonstrated through site-directed mutagenesis experiments where modified versions of COIII remained fully competent in proton translocation . COX3's primary contribution appears to be in structural stability and assembly of the enzyme complex rather than direct involvement in the electron transport chain.

What are the advantages of using Pichia species for recombinant COX3 expression compared to other systems?

Pichia expression systems offer several distinct advantages for recombinant COX3 expression compared to bacterial and mammalian systems:

CharacteristicsEscherichia coliPichia speciesCHO cell
Doubling time30 min60–120 min24 hr
Cost of growth mediumLowLowHigh
Complexity of growth mediumMinimumMinimumComplex
Expression levelHighLow to highLow to moderate
Extracellular expressionSecretion to periplasmSecretion to mediumSecretion to medium
Protein foldingRefolding usually requiredRefolding may be requiredProper folding
N‐linked glycosylationNoneHigh mannoseComplex
O‐linked glycosylationNoYesYes
Phosphorylation & acetylationNoYesYes
DrawbackAccumulation of LPSCodon biasContamination with animal viruses

The advantages of Pichia for COX3 expression include:

  • Post-translational modification capability while maintaining relatively simple culturing requirements

  • Lower tendency for hyperglycosylation compared to Saccharomyces cerevisiae

  • Absence of potentially immunogenic terminal α-1,3-linked mannoses found in S. cerevisiae

  • Proper protein folding mechanisms similar to higher eukaryotes

  • Strong inducible promoters coupled with high biomass generation

For membrane proteins like COX3, Pichia's eukaryotic membrane environment provides a more native-like folding environment than bacterial systems while maintaining higher yields than mammalian systems .

What protocols are most effective for extracting and purifying recombinant COX3 from Pichia canadensis?

While specific protocols for P. canadensis COX3 purification are not detailed in the provided sources, effective extraction and purification methods for membrane proteins like COX3 from Pichia typically involve:

  • Cell disruption methodology:

    • Mechanical disruption using glass beads or high-pressure homogenization is preferred for Pichia cells due to their robust cell walls

    • Buffer composition should include glycerol (10-15%) and protease inhibitors to stabilize the membrane protein

  • Membrane fraction isolation:

    • Differential centrifugation (3,000×g for 5 minutes to remove unbroken cells, followed by 30,000×g for 30-45 minutes to collect membrane fractions)

    • Detergent solubilization using mild non-ionic detergents (DDM, LMNG, or digitonin) at concentrations just above their critical micelle concentration

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) utilizing histidine tags

    • Size exclusion chromatography to ensure homogeneity

    • Throughout all steps, maintaining the pH between 7.0-7.5 and temperature at 4°C is critical to prevent proteolytic degradation

  • Proteolytic considerations:

    • Using protease-deficient strains (similar to SMD1163, SMD1165, SMD1168 used for P. pastoris) to minimize degradation of secreted proteins

    • Including specific protease inhibitors targeting proteinase A (encoded by pep4) and proteinase B (encoded by prb1)

These protocols should be optimized for P. canadensis specifically, with particular attention to detergent selection for maintaining COX3 stability and activity.

How does oxygen availability affect recombinant COX3 expression in Pichia canadensis?

Oxygen availability significantly influences recombinant protein expression in Pichia species. Although specific data for P. canadensis COX3 is not directly provided, research on recombinant protein expression in Pichia pastoris demonstrates that hypoxic conditions can have beneficial effects on protein secretion in chemostat cultivations . Under hypoxic conditions, Pichia species undergo substantial physiological adaptations that affect central carbon metabolism and protein production pathways.

The adaptation to hypoxia in Pichia shows distinct traits compared to the model yeast Saccharomyces cerevisiae, with strong correlation between transcriptomic, proteomic, and metabolic flux adaptations in core metabolism . These adaptations include:

  • Upregulation of glycolysis and pentose phosphate pathway genes

  • Transcriptional regulation of TCA cycle components

  • Important changes in lipid metabolism and stress response

For membrane proteins like COX3, hypoxic conditions may promote:

  • Altered membrane composition better suited for membrane protein integration

  • Reduced oxidative stress that might otherwise affect protein folding

  • Modified cell metabolism that could enhance energy availability for protein synthesis

The optimal oxygen level should be determined experimentally, but maintaining dissolved oxygen at 10-30% saturation during induction phases may provide a balanced environment for COX3 expression while avoiding severe hypoxic stress .

What induction strategies maximize COX3 yield while maintaining proper protein folding?

Optimizing induction strategies for COX3 expression requires balancing yield with proper protein folding. Based on research with recombinant protein expression in Pichia systems, effective induction strategies include:

  • Methanol induction protocol:

    • Gradually increase methanol concentration rather than immediate high-concentration shock

    • Maintain methanol concentration below 5% as higher concentrations can be toxic and halt production

    • Implement fed-batch strategy with controlled methanol feeding rate

  • Temperature modulation:

    • Lower cultivation temperature (20-25°C instead of 30°C) during induction phase

    • This reduces protein synthesis rate, allowing more time for proper folding of complex membrane proteins

  • Feeding strategy optimization:

    • Initial growth phase on glycerol to achieve high cell density

    • Transitional phase with slow glycerol feed rate and initial methanol addition

    • Production phase with optimized methanol feed rate based on specific growth rate

  • Chaperone co-expression:

    • Co-express molecular chaperones that assist in membrane protein folding

    • PDI (protein disulfide isomerase) or BiP (binding immunoglobulin protein) can improve folding efficiency

  • pH control:

    • Maintain pH between 5.0-6.0 during induction phase

    • Monitor pH shifts that might indicate metabolic changes or contamination

For membrane proteins like COX3, slower induction with careful methanol feeding coupled with lower temperature generally yields better results in terms of correctly folded, functional protein.

How can site-directed mutagenesis of COX3 be used to study proton translocation mechanisms?

Site-directed mutagenesis of COX3 has been instrumental in understanding its role in proton translocation. Research has shown that contrary to earlier assumptions, COX3 is not essential for proton pumping function. This was demonstrated through mutagenesis experiments targeting conserved carboxylic acid residues:

  • Targeted residue selection methodology:

    • Identify invariant carboxylic acids in COX3 sequence (e.g., E98 and D259 as studied in previous research)

    • Focus on the DCCD-binding glutamic acid residue (E98), which was previously thought to be crucial for proton translocation

    • Use sequence alignment across species to identify other conserved residues potentially involved in proton pathways

  • Mutagenesis approaches:

    • Replace targeted glutamic acid with non-protonatable residues (e.g., alanine, valine)

    • Create double mutants to test compensatory mechanisms

    • Develop gene knockout constructs to study enzyme assembly in absence of COX3

  • Functional analysis methods:

    • Spectroscopy and activity measurements to assess structural integrity and electron transfer function

    • Direct measurement of proton translocation in bacterial spheroplasts or reconstituted systems

    • Monitor H+/e- stoichiometry to quantify pumping efficiency

What methodologies can detect structural changes in recombinant COX3 under different respiratory conditions?

Detecting structural changes in recombinant COX3 under varying respiratory conditions requires sophisticated biophysical and biochemical techniques:

  • Advanced spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes

    • Fourier-transform infrared spectroscopy (FTIR) for detailed analysis of membrane protein conformation

    • Electron paramagnetic resonance (EPR) to study conformational changes around metal centers in the cytochrome complex

  • Fluorescence-based approaches:

    • Site-specific labeling with fluorescent probes at strategic positions in COX3

    • Fluorescence resonance energy transfer (FRET) to measure distances between domains

    • Monitoring mitochondrial membrane potential (ΔΨm) using potentiometric fluorescent dyes like those used in studies of cyanide-resistant respiration

  • Cross-linking mass spectrometry:

    • Chemical cross-linking of accessible residues under different respiratory states

    • Mass spectrometric analysis to identify differences in cross-linking patterns

    • This reveals dynamic conformational changes that occur during respiratory adaptation

  • Cryo-electron microscopy:

    • Capture structural states under defined respiratory conditions

    • Compare structures to identify conformational changes

    • Correlate structural changes with functional parameters

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Measures solvent accessibility of different protein regions

    • Identifies regions undergoing conformational changes during respiratory adaptation

    • Provides peptide-level resolution of structural dynamics

By combining these methodologies, researchers can correlate structural changes in COX3 with functional parameters such as oxygen consumption rates, ATP production, and proton pumping efficiency under different respiratory states.

What are common challenges in expressing functional COX3 in Pichia systems and how can they be addressed?

Expression of functional membrane proteins like COX3 in Pichia systems faces several challenges:

  • Protein misfolding and aggregation:

    • Solution: Optimize growth temperature (reduce to 20-25°C during induction)

    • Solution: Test different detergents for membrane protein extraction (DDM, LMNG, digitonin)

    • Solution: Co-express chaperones or foldases that assist membrane protein folding

  • Proteolytic degradation:

    • Solution: Use protease-deficient strains lacking proteinase A (pep4) and proteinase B (prb1) genes

    • Solution: Optimize pH during cultivation to minimize protease activity

    • Solution: Include appropriate protease inhibitor cocktails during extraction

  • Toxic effects on host cells:

    • Solution: Use tightly regulated promoters to prevent leaky expression

    • Solution: Implement fed-batch strategies to control expression rate

    • Solution: Monitor cell viability and adjust induction parameters accordingly

  • Poor incorporation into membranes:

    • Solution: Engineer constructs with optimized signal sequences

    • Solution: Modify membrane composition through media supplementation with specific lipids

    • Solution: Consider fusion partners that facilitate membrane targeting

  • Methanol toxicity during induction:

    • Solution: Keep methanol concentration below 5% as higher levels are toxic

    • Solution: Implement sensor-based methanol feeding strategies

    • Solution: Test alternative promoters that require lower methanol concentrations

  • Contamination issues:

    • Solution: Implement strict aseptic techniques as contamination with saprophytic bacteria and fungi can lead to protease release that hydrolyzes secreted proteins

    • Solution: Use selective antibiotics when possible

    • Solution: Monitor cultures regularly for contamination indicators

By systematically addressing these challenges, researchers can significantly improve the yield and functionality of recombinant COX3 expressed in Pichia systems.

How can researchers assess whether recombinant COX3 maintains native conformation and functionality?

Assessing the native conformation and functionality of recombinant COX3 requires multiple complementary approaches:

  • Spectroscopic characterization:

    • UV-visible spectroscopy to confirm characteristic absorption peaks of cytochrome complexes

    • Circular dichroism (CD) to compare secondary structure elements with native enzyme

    • Fluorescence spectroscopy to evaluate tertiary structure integrity

  • Enzymatic activity assays:

    • Oxygen consumption measurements using oxygen electrodes

    • Polarographic analysis of electron transfer rates

    • Assessment of sensitivity to specific inhibitors like DCCD (which modifies a conserved glutamic acid residue in COX3 and affects proton translocation activity)

  • Proton pumping functionality:

    • Measurement of proton translocation in reconstituted proteoliposomes

    • Analysis of pH changes during enzyme activity

    • Comparison with native enzyme or known mutants with characterized proton pumping deficiencies

  • Structural integrity assessment:

    • Size exclusion chromatography to confirm proper assembly and oligomeric state

    • Blue native PAGE to analyze complex formation

    • Limited proteolysis to probe for correct folding (properly folded proteins often show distinct proteolysis patterns)

  • Interaction studies:

    • Co-immunoprecipitation with known interaction partners

    • Surface plasmon resonance to measure binding kinetics with cytochrome c

    • Cross-linking studies to confirm proximity of subunits in assembled complex

The gold standard for functionality assessment combines multiple approaches, particularly comparing oxygen consumption rates and proton pumping efficiency with those of the native enzyme complex. Researchers should also verify that the recombinant COX3 assembles correctly with other subunits to form the complete cytochrome c oxidase complex.

How can recombinant COX3 studies contribute to understanding mitochondrial disorders?

Recombinant COX3 studies can significantly advance our understanding of mitochondrial disorders through multiple research approaches:

  • Disease-associated mutation analysis:

    • Recombinant expression of COX3 variants containing pathogenic mutations

    • Functional characterization of how specific mutations affect assembly, stability, and activity

    • Correlation of biochemical defects with clinical manifestations

  • Structure-function relationship clarification:

    • Site-directed mutagenesis to systematically analyze the importance of conserved residues

    • Combined with structural studies to create comprehensive models of COX3 function

    • This knowledge helps interpret patient mutations in a mechanistic context

  • Drug screening platforms:

    • Develop assays using recombinant COX3 for screening compounds that might rescue mutant function

    • Test small molecules that could stabilize defective COX3 proteins

    • Establish cell-based assays incorporating recombinant COX3 variants for therapeutic discovery

  • Interspecies comparison studies:

    • Compare COX3 from different species including P. canadensis to identify conserved functional domains

    • Use evolutionary analyses to distinguish essential vs. adaptable regions

    • This helps prioritize regions for therapeutic targeting

  • Assembly factor studies:

    • Identify proteins that interact with COX3 during assembly

    • Characterize how these interactions are affected in disease states

    • Potentially identify new disease genes involved in COX3 assembly

The research on COX3's role has already challenged previous assumptions about its function in proton pumping , demonstrating how recombinant protein studies can revise fundamental understanding of respiratory chain components relevant to mitochondrial diseases.

What emerging technologies might enhance our ability to study COX3 structure and function?

Several cutting-edge technologies are poised to revolutionize COX3 research:

  • Cryo-electron microscopy advances:

    • Latest detectors and processing algorithms enable atomic-resolution structures of membrane protein complexes

    • Time-resolved cryo-EM to capture COX3 in different conformational states during catalytic cycle

    • Visualizing COX3 interactions within the complete cytochrome c oxidase complex

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes during enzyme operation

    • Optical tweezers coupled with electrical measurements to correlate mechanical changes with proton movements

    • These approaches overcome limitations of ensemble averaging in traditional biochemical assays

  • Genome editing in model systems:

    • CRISPR-Cas9 technologies to create precise mutations in COX3 in various model organisms

    • Rapid generation of disease models for testing hypotheses about COX3 function

    • Development of humanized yeast models with patient-derived COX3 variants

  • Computational approaches:

    • Molecular dynamics simulations of COX3 in membrane environments

    • Quantum mechanical/molecular mechanical (QM/MM) calculations to model electron transfer

    • Machine learning algorithms to predict effects of mutations on protein stability and function

  • Synthetic biology approaches:

    • Minimal synthetic systems reconstituted with defined components

    • Designer COX3 variants with novel functions or enhanced stability

    • Integration of artificial electron transport chains in synthetic cellular systems

  • Advanced imaging:

    • Super-resolution microscopy to visualize COX3 distribution and dynamics in mitochondria

    • Correlative light and electron microscopy (CLEM) to connect functional states with structural features

    • Label-free imaging technologies to study native COX3 without potentially disruptive tags

These emerging technologies will enable researchers to address longstanding questions about COX3 structure, function, and role in disease states with unprecedented precision and detail.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.