Recombinant Pichia canadensis NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pichia canadensis NADH-Ubiquinone Oxidoreductase Chain 3 (ND3)

Recombinant Pichia canadensis NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial protein subunit of complex I, a critical component of the electron transport chain. This recombinant protein is engineered for expression in E. coli with an N-terminal His tag to facilitate purification and characterization . Below is a structured analysis of its properties, production, applications, and research findings.

Production and Purification

3.1 Expression Systems
ND3 is typically expressed in E. coli due to:

  • Efficiency: High yield and cost-effectiveness for recombinant protein production .

  • Tagging: N-terminal His tag enables metal affinity chromatography (IMAC) purification .

Diagnostic and Research Tools

  • ELISA applications: Recombinant ND3 is used as an antigen in enzyme-linked immunosorbent assays to detect anti-ND3 antibodies .

  • Proteomic studies: Mass spectrometry (MS) and SDS-PAGE/HPLC are employed to analyze ND3’s integration into complex I .

Challenges and Future Directions

Production Optimization

  • Oxygen-dependent yield: Low oxygen conditions in Pichia cultures may impact recombinant protein secretion, though this is less relevant for E. coli-expressed ND3 .

  • Genome editing: Advances in CRISPR/Cas9 systems for Pichia species could improve strain engineering, but ND3 remains E. coli-based .

Functional Studies

  • Electron transfer mechanisms: Further research is needed to elucidate ND3’s role in proton translocation and redox coupling .

  • Disease relevance: Complex I dysfunction is linked to mitochondrial disorders; ND3 studies may inform therapeutic strategies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for users.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Wickerhamomyces canadensis (Yeast) (Pichia canadensis)
Target Names
ND3
Target Protein Sequence
MLNYFVYPYGIENDIGIKFYMILVPIISIVLIIINYIITNKSDNNINKTGPYECGFDSFR QSRTTYSIKFILIAILFLPFDLELTSILPYTLSIYNLNIYGLFILLYFLLPLIIGFIIEI NLKAIYITKIFNRNVKSITSYVKYNNKI
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), essential for catalysis. It is believed to belong to the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone considered the immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does ND3 contribute to the electron transport chain mechanism?

ND3 functions as an integral component of Complex I (NADH:ubiquinone oxidoreductase), which is the first enzyme in the mitochondrial electron transport chain. This complex contains multiple subunits that work together to transfer electrons from NADH to ubiquinone. ND3 specifically contributes to this process through its positioning within the membrane domain of the complex, where it participates in proton pumping across the inner mitochondrial membrane .

The protein's highly hydrophobic nature facilitates its integration into the membrane domain of Complex I, where it interacts with other subunits to maintain the structural integrity necessary for electron transport. Mutations in ND3 can significantly impair Complex I activity, highlighting its critical role in the electron transport mechanism. In human mitochondria, ND3 mutations are associated with several mitochondrial diseases including Leigh Syndrome and Mitochondrial Complex I Deficiency, demonstrating the evolutionary conservation of this protein's importance across species .

Why are researchers interested in recombinant expression of Pichia canadensis ND3?

Researchers focus on recombinant expression of Pichia canadensis ND3 for several compelling reasons. First, obtaining sufficient quantities of native ND3 from mitochondrial preparations is challenging due to low natural abundance and difficulties in isolation. Recombinant expression systems offer a solution by enabling production of larger quantities of pure protein for structural and functional studies .

Second, recombinant expression allows for protein engineering approaches, including the addition of affinity tags like His-tags, which significantly simplify purification procedures. The commercially available recombinant Pichia canadensis ND3 includes an N-terminal His-tag, facilitating efficient purification through affinity chromatography .

Third, studies on ND3 contribute to our understanding of mitochondrial diseases. Although Pichia canadensis is a yeast species, insights gained from studying its ND3 can be applicable to understanding human mitochondrial disorders, as the respiratory chain components show evolutionary conservation across species .

Finally, recombinant ND3 serves as a valuable tool for developing and testing therapies targeting mitochondrial dysfunction, given the protein's central role in cellular energy production.

What expression systems are optimal for recombinant Pichia canadensis ND3 production?

The selection of an appropriate expression system for Pichia canadensis ND3 is critical for obtaining functional protein. Based on available research, E. coli and Pichia pastoris represent the two most effective systems, each with distinct advantages depending on research objectives.

E. coli expression systems offer rapid growth, high protein yields, and well-established protocols. Current commercial production of recombinant Pichia canadensis ND3 utilizes E. coli systems, resulting in full-length protein (1-148 amino acids) fused to an N-terminal His-tag . This approach provides substantial yields of protein suitable for applications such as SDS-PAGE and immunological studies.

Alternatively, Pichia pastoris (now classified as Komagataella phaffii) presents several advantages for expressing eukaryotic membrane proteins:

  • As a yeast, P. pastoris provides a eukaryotic cellular environment that may support proper folding of ND3

  • The pPICZαA vector system enables secretion of recombinant proteins into the culture medium via the α-factor secretion signal

  • Induction with methanol allows for controlled expression through the AOX1 promoter

  • High cell density cultures can achieve protein yields up to 300 mg/L of purified protein

A comparative analysis of both systems would typically include:

Expression SystemAdvantagesLimitationsTypical YieldPost-translational Modifications
E. coliRapid growth, simple media, well-established protocolsLimited post-translational modifications, inclusion body formation10-100 mg/LMinimal
Pichia pastorisEukaryotic folding machinery, high-density fermentation, protein secretionLonger expression time, complex media requirementsUp to 300 mg/LGlycosylation, disulfide bond formation

The selection between these systems should be guided by specific research requirements, particularly regarding protein folding, post-translational modifications, and downstream applications.

What are the key considerations for optimizing recombinant ND3 expression in Pichia pastoris?

Optimizing recombinant ND3 expression in Pichia pastoris requires careful attention to several critical parameters. The transformation and selection of suitable recombinant clones represent the initial considerations. Typically, the pPICZαA vector containing the ND3 gene (excluding the native signal peptide) is linearized and transformed into P. pastoris strain KM71H(Muts). Selection on zeocin-containing media identifies successful transformants that can be further screened for expression levels .

Culture conditions significantly impact expression efficiency. For optimal results, a two-phase cultivation process is recommended:

  • Initial growth phase: Cultivation in buffered glycerol-complex medium (BMGY) at 30°C with shaking at 250 rpm until achieving sufficient biomass (typically OD600 = 6)

  • Induction phase: Transfer to buffered methanol-complex medium (BMMY) containing 1% methanol, with daily supplementation of 0.75% methanol to maintain induction

Temperature, pH, and methanol concentration require careful optimization. While standard conditions include cultivation at 30°C and pH 6.5, lower temperatures (20-25°C) may improve protein folding for complex membrane proteins like ND3. The methanol feeding strategy is particularly crucial, as insufficient methanol limits induction while excess can be toxic to cells.

Expression time optimization also plays a vital role. For example, in a comparable study with endoglucanase III from Trichoderma harzianum, optimal expression was achieved after a specific induction period, with longer times potentially leading to protein degradation . Similar time-course experiments are advisable for ND3 expression to determine the optimal harvest point.

What purification strategies yield the highest purity and activity for recombinant Pichia canadensis ND3?

Purification of recombinant Pichia canadensis ND3 requires a multi-step approach to achieve high purity while preserving biological activity. The inclusion of an affinity tag, typically an N-terminal His-tag, facilitates initial capture through immobilized metal affinity chromatography (IMAC) .

A comprehensive purification protocol should include the following steps:

  • Initial clarification: Centrifugation of expression culture (1500 g for 5 minutes) followed by filtration through a 0.22-μm membrane to remove cells and debris

  • Affinity chromatography: Application of filtered supernatant to a nickel-charged affinity column, with binding in appropriate buffer conditions (typically Tris-HCl pH 7.0-8.0 with 5-20 mM imidazole to reduce non-specific binding)

  • Washing steps: Multiple column washes with increasing imidazole concentrations to remove non-specifically bound proteins

  • Elution: Recovery of His-tagged ND3 with higher imidazole concentrations (typically 250-500 mM)

  • Buffer exchange/dialysis: Removal of imidazole through extensive dialysis against an appropriate storage buffer. For membrane proteins like ND3, inclusion of stabilizing agents such as glycerol is recommended

  • Concentration determination: Protein quantification using methods such as the BCA Protein Assay

For challenging membrane proteins like ND3, additional purification steps may be necessary, including ion-exchange chromatography or size-exclusion chromatography to achieve homogeneity. Throughout the purification process, activity assays should be conducted to ensure functionality is maintained. SDS-PAGE analysis at each step helps monitor purity and integrity of the target protein.

How can researchers assess the structural integrity and functionality of recombinant ND3?

Assessing the structural integrity and functionality of recombinant ND3 requires a multi-faceted approach combining biophysical, biochemical, and enzymatic techniques. For structural characterization, SDS-PAGE analysis provides initial confirmation of protein integrity and purity. Western blotting using specific antibodies against either the His-tag or ND3 itself can confirm identity and detect potential degradation products .

Circular dichroism (CD) spectroscopy offers insights into secondary structure elements, particularly important for membrane proteins like ND3. The expected spectrum should reflect the predominantly α-helical structure typical of mitochondrial membrane proteins.

For functional assessment, NADH dehydrogenase activity assays are essential. These typically involve monitoring the rate of NADH oxidation spectrophotometrically at 340 nm in the presence of appropriate electron acceptors such as ubiquinone or artificial electron acceptors. The activity can be expressed as μmol NADH oxidized per minute per mg of protein.

A comprehensive assessment protocol might include:

  • Structural integrity:

    • SDS-PAGE analysis for molecular weight confirmation and purity assessment

    • Western blotting with anti-His and anti-ND3 antibodies

    • Mass spectrometry for accurate mass determination and sequence verification

    • Circular dichroism spectroscopy for secondary structure analysis

  • Functional characterization:

    • NADH:ubiquinone oxidoreductase activity assays

    • Complex I assembly assays (if studying the protein in the context of the entire complex)

    • Reconstitution into liposomes to assess membrane-associated functions

  • Stability assessment:

    • Thermal shift assays to determine protein stability under various conditions

    • Activity retention during storage at different temperatures (-20°C/-80°C)

The results from these complementary approaches provide a robust evaluation of whether the recombinant ND3 maintains native-like properties after expression and purification.

What are the common challenges in maintaining stability of recombinant ND3 and how can they be addressed?

Maintaining stability of recombinant Pichia canadensis ND3 presents several challenges due to its hydrophobic nature as a membrane protein. The primary stability issues include aggregation, oxidation, and loss of structural integrity during storage and experimental procedures.

Aggregation frequently occurs when membrane proteins are removed from their native lipid environment. To mitigate this challenge, incorporation of mild detergents or lipid mimetics in storage buffers is recommended. Additionally, storing the protein at higher concentrations (0.1-1.0 mg/mL) can reduce surface adsorption losses .

Oxidation of sulfhydryl groups and methionine residues represents another destabilizing factor. The addition of reducing agents such as DTT or β-mercaptoethanol at low concentrations can help maintain redox-sensitive residues in their reduced state.

Freeze-thaw cycles significantly contribute to protein degradation. Based on established protocols, repeated freezing and thawing should be strictly avoided. Instead, researchers should prepare small working aliquots for single use . For long-term storage, the addition of cryoprotectants is crucial. Current recommendations suggest:

  • Adding 6% trehalose to storage buffer (Tris/PBS-based, pH 8.0)

  • Incorporating 5-50% glycerol (optimal concentration: 50%) before aliquoting for storage at -20°C/-80°C

Temperature management is equally important. While -80°C storage is preferable for long-term preservation, working aliquots can be maintained at 4°C for up to one week without significant activity loss .

A systematic stability study comparing different storage conditions would typically analyze both structural integrity (via SDS-PAGE and Western blotting) and functional activity (via enzymatic assays) at designated time points. Such studies provide valuable data for optimizing storage protocols specific to recombinant ND3.

How can researchers troubleshoot low expression yields of recombinant ND3?

Low expression yields of recombinant Pichia canadensis ND3 can result from multiple factors throughout the expression process. A systematic troubleshooting approach addressing each potential limitation point can significantly improve outcomes.

For E. coli expression systems, codon optimization represents a critical consideration. The codon usage in Pichia canadensis differs significantly from E. coli, potentially leading to translational pauses or premature termination. Analyzing the codon adaptation index (CAI) and optimizing the sequence for E. coli expression can enhance translation efficiency.

When using Pichia pastoris as an expression host, several specific strategies can address yield limitations:

  • Clone selection optimization: Screen multiple transformants to identify high-expressing clones. Expression levels can vary substantially between individual transformants due to differences in integration site and copy number .

  • Induction protocol refinement: Methanol concentration and feeding strategy significantly impact expression. Optimize the initial methanol concentration (typically starting with 1%) and supplementation frequency (standard: 0.75% daily) . Consider implementing a fed-batch strategy with controlled methanol addition based on oxygen consumption.

  • Culture conditions adjustment: Optimize temperature, pH, and dissolved oxygen levels. While standard conditions include 30°C and pH 6.5, lower temperatures (20-25°C) during induction can improve folding of complex proteins like ND3 .

  • Expression time optimization: Conduct time-course experiments to determine the optimal harvest point, as prolonged expression can lead to proteolytic degradation rather than accumulation.

  • Protease inhibition: Pichia pastoris secretes various proteases that may degrade the target protein. Adding protease inhibitors to the culture medium or using protease-deficient strains can improve yields.

A methodical approach to troubleshooting typically involves changing one parameter at a time and assessing its impact on expression levels through techniques such as SDS-PAGE and Western blotting, allowing for evidence-based optimization of the expression protocol.

How do mutations in ND3 affect its function in the electron transport chain?

Mutations in ND3 can profoundly impact electron transport chain function through several mechanisms affecting protein structure, stability, and interactions within Complex I. Studies on the human mitochondrial ND3 gene (MT-ND3) provide valuable insights applicable to understanding the effects of mutations in Pichia canadensis ND3, given the evolutionary conservation of respiratory chain components.

Mutations in ND3 are associated with several human mitochondrial disorders, including Leigh Syndrome and Mitochondrial Complex I Deficiency . These pathological conditions manifest due to compromised energy production resulting from electron transport chain dysfunction.

The functional consequences of ND3 mutations can be categorized as follows:

  • Catalytic site disruption: Mutations within or near the catalytic domain can directly impair NADH dehydrogenase activity. This reduces the efficiency of electron transfer to ubiquinone, diminishing ATP production capacity.

  • Proton pumping interference: As Complex I couples electron transfer to proton translocation across the inner mitochondrial membrane, mutations affecting the membrane-embedded regions of ND3 can disrupt proton pumping, reducing the proton gradient necessary for ATP synthesis.

  • Complex assembly disruption: Some mutations affect the proper assembly of Complex I rather than directly impacting catalytic function. These mutations can prevent ND3 integration into the complex or destabilize interactions with other subunits.

  • ROS production enhancement: Certain mutations increase reactive oxygen species (ROS) production by promoting electron leakage from the transport chain, causing oxidative stress and cellular damage.

Experimental approaches to study mutation effects include site-directed mutagenesis to introduce specific mutations into the recombinant ND3 gene, followed by expression and functional characterization. The impact on electron transport can be measured through NADH:ubiquinone oxidoreductase activity assays, while structural effects can be assessed through techniques such as CD spectroscopy or limited proteolysis.

What computational approaches are valuable for predicting ND3 structure-function relationships?

Computational approaches provide powerful tools for investigating ND3 structure-function relationships, complementing experimental studies and guiding hypothesis generation. Several methods are particularly valuable for researchers working with Pichia canadensis ND3.

Homology modeling represents a fundamental approach for predicting ND3 structure. This method leverages structural information from homologous proteins, typically using resolved structures of Complex I from model organisms as templates. For Pichia canadensis ND3, structures from closely related species can serve as templates, with sequence alignment guiding the modeling process. Modern tools such as AlphaFold2 or RoseTTAFold have significantly improved prediction accuracy for membrane proteins.

Molecular dynamics (MD) simulations offer insights into protein dynamics and stability. For membrane proteins like ND3, simulations in explicit lipid bilayers are particularly informative, revealing conformational changes associated with function and potential effects of mutations. These simulations typically require:

  • System preparation with the protein embedded in a lipid bilayer

  • Energy minimization and equilibration steps

  • Production MD runs (typically 100ns-1μs)

  • Analysis of trajectory data for structure-function insights

Quantum mechanical/molecular mechanical (QM/MM) methods are especially valuable for studying electron transfer mechanisms within ND3 and Complex I. These hybrid approaches treat the active site at a quantum mechanical level while representing the remainder of the system with molecular mechanics, enabling accurate modeling of electronic processes.

Sequence-based prediction tools complement structural modeling by identifying functional motifs, transmembrane regions, and conserved residues. Tools such as TMHMM for transmembrane helix prediction and ConSurf for evolutionary conservation analysis can highlight functionally important regions of ND3.

Integrative approaches combining multiple computational methods with experimental data typically yield the most reliable predictions of structure-function relationships, guiding experimental design and interpretation of results.

How can researchers resolve contradictory results when analyzing ND3 activity data?

Resolving contradictory results in ND3 activity analyses requires a systematic approach addressing potential sources of variability and experimental artifacts. When faced with inconsistent findings, researchers should consider several critical factors that may contribute to data discrepancies.

Experimental conditions represent a primary source of variability. Activity assays for redox proteins like ND3 are highly sensitive to buffer composition, pH, temperature, and the presence of specific ions. Standardization of these parameters across experiments is essential for obtaining comparable results. When contradictory findings emerge from different studies, detailed comparison of experimental conditions can often identify key variables responsible for discrepancies .

Protein preparation methods significantly impact activity measurements. Variations in expression systems, purification protocols, and protein storage conditions can alter the structural integrity and functionality of ND3. When troubleshooting contradictory results, researchers should:

  • Assess protein purity through multiple methods (SDS-PAGE, mass spectrometry)

  • Verify protein identity through Western blotting or mass spectrometry

  • Evaluate protein stability under the specific assay conditions

  • Consider the influence of affinity tags on protein function

Assay methodology differences often underlie contradictory findings. For NADH dehydrogenase activity, variations in electron acceptors (natural ubiquinone vs. artificial acceptors), detection methods, and assay formats can produce divergent results. Comparative analysis using multiple methodological approaches can help establish the reliability of specific findings.

Statistical analysis plays a crucial role in resolving contradictions. Rigorous statistical treatment, including appropriate tests for significance and consideration of biological variability, helps distinguish meaningful differences from experimental noise. Researchers should:

  • Ensure adequate sample sizes and technical replicates

  • Apply appropriate statistical tests based on data distribution

  • Consider the biological significance of statistically significant differences

  • Implement controls that account for systematic errors

Collaborative validation through independent laboratories provides perhaps the most robust approach to resolving persistent contradictions in ND3 activity data, allowing identification of laboratory-specific variables that may influence experimental outcomes.

What emerging technologies show promise for advancing ND3 research?

Emerging technologies are poised to transform research on recombinant Pichia canadensis ND3, offering unprecedented insights into its structure, function, and interactions. These innovative approaches span multiple disciplines and promise to address longstanding challenges in ND3 research.

Cryo-electron microscopy (cryo-EM) represents a revolutionary advancement for membrane protein structural biology. Unlike X-ray crystallography, cryo-EM does not require protein crystallization, a significant hurdle for membrane proteins like ND3. Recent improvements in resolution have enabled atomic-level insights into respiratory chain complexes. Applied to purified recombinant ND3 or ND3-containing subcomplexes, cryo-EM could reveal critical structural features that influence function.

Native mass spectrometry has emerged as a powerful tool for studying membrane protein complexes in their near-native states. This technique can determine the stoichiometry of protein-protein interactions and identify small molecule binding, potentially revealing how ND3 integrates into Complex I and interacts with other respiratory chain components.

CRISPR-based approaches for studying ND3 in cellulo are increasingly accessible. CRISPR/Cas9-mediated genome editing allows precise manipulation of the endogenous ND3 gene, enabling studies of ND3 function in its natural cellular context rather than as an isolated recombinant protein. This approach could be particularly valuable for investigating ND3's interactions with other mitochondrial components.

Microfluidic systems and lab-on-a-chip technologies offer innovative platforms for high-throughput screening of ND3 activity under various conditions. These systems require minimal amounts of protein and can rapidly test multiple parameters, accelerating optimization of expression, purification, and activity assays.

Computational approaches continue to advance rapidly. Recent developments in artificial intelligence and machine learning, exemplified by AlphaFold2's remarkable success in protein structure prediction, provide increasingly accurate models of complex membrane proteins. These computational tools, combined with experimental validation, offer a powerful strategy for understanding ND3 structure-function relationships.

What potential applications exist for recombinant ND3 beyond basic research?

While recombinant Pichia canadensis ND3 is primarily utilized in fundamental research, several promising applications extend beyond basic science. These applications leverage ND3's central role in bioenergetics and its evolutionary relationship to human mitochondrial proteins.

Drug discovery platforms targeting mitochondrial disorders represent a significant application area. Recombinant ND3 can serve as a screening target for compounds that modulate Complex I activity, potentially identifying therapeutic candidates for mitochondrial diseases. The advantage of using Pichia canadensis ND3 in initial screens lies in its robust expression and stability compared to human mitochondrial proteins, while maintaining sufficient structural similarity to serve as a relevant model .

Biosensor development utilizing ND3's electron transfer capabilities presents another innovative application. By coupling ND3 to appropriate detection systems, researchers could develop sensors for monitoring mitochondrial function or detecting compounds that affect electron transport. Such biosensors could find applications in environmental toxicology for identifying compounds that disrupt mitochondrial respiration.

Bioenergy research represents a growing field where ND3 studies contribute valuable insights. Understanding the molecular mechanisms of electron transport in diverse organisms like Pichia canadensis enhances our knowledge of natural bioenergetic systems, potentially inspiring bio-inspired energy conversion technologies.

Evolutionary medicine applications emerge from comparative studies of ND3 across species. By examining functional conservation and divergence between Pichia canadensis ND3 and human MT-ND3, researchers gain insights into fundamental aspects of mitochondrial function that withstand evolutionary pressure, highlighting critical functional domains that could serve as therapeutic targets .

Educational tools for biochemistry and molecular biology represent a practical application for recombinant ND3. Well-characterized recombinant proteins provide valuable resources for teaching concepts in protein expression, purification, and enzymatic activity assays in academic settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.